Recombinant Mouse Alpha-2-antiplasmin (Serpinf2)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Serpinf2

Purity

>85% (SDS-PAGE)

Target Names

Serpinf2

Uniprot NO.

Q61247

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

40-491aa

Target Protein Sequence

AQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRMEEDYPQFSSPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin.

Gene References into Functions

These results suggest that alpha2AP negatively affects osteoblast differentiation and function by inhibiting the Wnt/beta-catenin pathway. PMID:28677806
alpha2AP has a profibrotic effect probably not by the action as a plasmin inhibitor, and the blocking of alpha2AP exerts an antifibrotic effect in humans and mice with systemic sclerosis PMID:26743600
A2AP is not significantly affected by the Pla protease during pneumonic plague, and although A2AP participates in immune modulation in the lungs, it has limited impact on the course or ultimate outcome of the infection. PMID:26438794
a2AP deficiency enhanced thrombus dissolution, increased cerebral blood flow, reduced brain infarction, and decreased brain swelling. PMID:25256235
our findings suggest that alpha2AP is a crucial mediator of motor function, cognitive function, anxiety-like behavior and depression-like behavior, providing new insights into the role of alpha2AP in the brain functions. PMID:24874880
Alpha 2 antiplasmin is involved in the recruitment of lymphocytes in the peripheral tissues.Alpha 2 antiplasmin contributes to the maintenance of immunological functions that are related to IgE. PMID:23770230
alpha2AP is associated with the progression of fibrosis. PMID:20008146
Plasmin/alpha(2)-AP system played an important role in hepatic repair via clearance from the injury area. PMID:14672621
PgtE mediated degradation of the antiprotease alpha(2)-antiplasmin leads to functional inactivation of the antiprotease in infected macrophages PMID:15760453
The lack of alpha2AP attenuated TGF-beta(1) synthesis, thereby resulting in attenuated fibrosis PMID:17958745
2.65A X-ray crystal structure of an N-terminal truncated murine alpha(2)-antiplasmin. PMID:18063751
Results show that alpha2-antiplasmin is a critical regulator for vascular remodeling by inhibiting p53/p21 pathway. PMID:18436805