Home
Product
Protein
Recombinant Proteins
Recombinant Moloney murine leukemia virus Gag polyprotein (gag), partial

Recombinant Moloney murine leukemia virus Gag polyprotein (gag), partial

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

gag

Uniprot NO.

P03332

Species

Moloney murine leukemia virus (isolate Shinnick) (MoMLV)

Source

Yeast

Expression Region

216-478aa

Target Protein Sequence

PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLG TLLTGEEKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVHYRQ LLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSM SFIWQSAPDIGRKLERLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERR RTEDEQKEKERDRRRHREMSKLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

Which mammalian cell is used to manufacture this recombinant protein?

The host cell that we generally use for Mammalian cell expression system is HEK295 cells.

Target Background

Function(From Uniprot)

Plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably links the viral protein to the host ESCRT pathway and facilitates release.; Targets Gag and gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the pre-integration complex.; Constituent of the pre-integration complex (PIC) which tethers the latter to mitotic chromosomes.; Forms the spherical core of the virion that encapsulates the genomic RNA-nucleocapsid complex.; Involved in the packaging and encapsidation of two copies of the genome. Binds with high affinity to conserved UCUG elements within the packaging signal, located near the 5'-end of the genome. This binding is dependent on genome dimerization.

Gene References into Functions

The structure of the minimal sequence of the murine leukemia virus p12 protein necessary for the host chromatin binding was elucidated. PMID:27707926
Phosphorylation requirement of murine leukemia virus p12 virus p12 protein necessary for the host chromatin binding was elucidated. PMID:27707931
The N-terminal intracellular domain of the glycoGag is responsible for its effect on HIV-1 infectivity. PMID:24403584
Authors found that mature Gag proteins MA and TM were bound to the immature core consisting of the Gag polyprotein (PrGag) and viral RNA (vRNA). PMID:23643491
in presence of nucleocapsid (NC) chaperone, RNA dimerization occurred rapidly through a single structural intermediate; NC interacted primarily with guanosine residues; results show RNA chaperones can simplify RNA folding landscapes by weakening intramolecular interactions involving guanosine PMID:23470731
selective packaging of dimeric RNA is explained by the nucleic acid binding domain derived from Gag binding within the virus to the sequence UCUG-UR-UCUG PMID:20974908
results suggest a cooperative effect of p12 and capsid during the early events of MLV replication PMID:15767417
interaction of Gag with Tsg101 and Alix favors budding from the plasma membrane and relieves a requirement for ubiquitination by Nedd4 PMID:15908698
results indicate that glycosylated gag protein is important for M-MuLV replication in vivo and in vitro and that the protein may be involved in a late step in viral budding or release PMID:17267509
Abl protein contribute to proper localization by playing a dominant role in trafficking of the v-Abl molecule PMID:18367522
Basal budding and replication of the murine leukemia virus are independent of the gag L domains PMID:18667521

Hide All

Subcellular Location

[Gag polyprotein]: Virion. Host cell membrane; Lipid-anchor. Host late endosome membrane; Lipid-anchor. Host endosome, host multivesicular body.; [Matrix protein p15]: Virion.; [Capsid protein p30]: Virion.; [Nucleocapsid protein p10-Gag]: Virion.; [RNA-binding phosphoprotein p12]: Host cytoplasm.

Database Links

KEGG: vg:1491870

Promotions