Purity
Greater than 85% as determined by SDS-PAGE.
Species
Mesocricetus auratus (Golden hamster)
Expression Region
26-393aa
Target Protein Sequence
KTVLLGREGKSIELPCDGSQRKSAVFTWKLSDQTKILGNNKQSNFVARAQSERFSRFDSRKAAWDRGSFPLVINKLKVEDSNTYICEVENKKTEVELWVFKLTVSPDVRLLQGQTLTLRLDSSSKVTNPSMKCSGPGDRVVTDSRVYSVPNLRIQDSGIWTCIVTQNQKKETVNIDISVLGFQKTSTTVYTRDGESAEFSFPLNFGDENLQGELKWRTEKDPSPSPWVTFSLENRKVTMAKDTRKLQMAEELPLRLKILQVSLENAGSGNLTLTLAKGTLHQEVTLVVLKLTQNNNILTCEVRGPTSPKMRLTLVPEKQEARVSKQEKVVEVPDPEAGLWRCVLYEAEEVKMNADIQVSSRGLNQDQP
Mol. Weight
70.09999999999999
Tag Info
N-terminal GST-tagged and C-terminal Strep II-tagged
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.