Abbreviation
Recombinant Rhesus macaque IFNGR1 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG(CSB-MP011050MOW) at 2 μg/mL can bind Macaca mulatta IFNGR1.The EC50 is 1.329-1.813 ng/mL.
Alternative Names
Interferon gamma receptor 1; Interferon gamma receptor alpha-chain
Species
Macaca mulatta (Rhesus macaque)
Expression Region
18-246aa
Target Protein Sequence
EMGTADLGPSSVPIPTNVTIESYNMNTIVYWEYQNMPQDPVFTVEVKNYGVKNAEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSKEFAVCRDGKIGPPKLDIRKEEKQIIIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLVIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG(CSB-MP011050MOW) at 2 μg/ml can bind Macaca mulatta IFNGR1.The EC50 is 1.329-1.813 ng/mL.
-
The purity of IFNGR1 was greater than 95% as determined by SEC-HPLC
Description
Interferon gamma receptor 1 mediates cellular responses to IFN-γ, a cytokine central to macrophage activation, antigen presentation, and adaptive immunity, making its extracellular domain a critical target for studying cytokine signaling in primate models. This mammalian-expressed construct spanning residues 18–246 captures the ligand-binding domain and demonstrates quantified binding to rhesus IFN-γ with an EC50 of 1.329–1.813 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening. The measured affinity supports its use in therapeutic antibody epitope mapping, small-molecule inhibitor screening, and as a positive control in surface plasmon resonance or biolayer interferometry experiments characterizing IFN-γ pathway modulators. Mammalian expression preserves native glycosylation and disulfide architecture essential for physiological binding, while purity exceeding 95% by SEC-HPLC and endotoxin below 1.0 EU/μg satisfy the stringent criteria typical for cell-based assays and in vitro pharmacology studies in immunology research.