Recombinant Macaca fascicularis Erythropoietin (EPO)

In Stock
Code: CSB-MP007743MOV
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$500
Quantity:
Express system: Mammalian cell
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: N-terminal 6xHis-Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
EPO
Uniprot NO.
Research Area
Cardiovascular
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
28-192aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Macaca fascicularis Erythropoietin (EPO) is produced in a mammalian cell expression system, which appears to ensure appropriate post-translational modifications. The protein corresponds to the full-length mature sequence and includes an N-terminal 6xHis-Myc tag for ease of purification and detection. With a purity greater than 85% as determined by SDS-PAGE, this product seems suitable for research applications requiring high-quality recombinant proteins.

Erythropoietin (EPO) is a vital glycoprotein hormone primarily responsible for regulating red blood cell production (erythropoiesis) in the bone marrow. It plays an essential role in maintaining the oxygen-carrying capacity of the blood and serves as a key factor in response to hypoxia. EPO is also involved in various signaling pathways and has become a significant focus in hematology and regenerative medicine research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Macaca fascicularis EPO is a complex glycoprotein hormone that requires precise folding, proper disulfide bond formation, and specific glycosylation patterns for its functional activity in erythropoiesis. The mammalian cell expression system provides the necessary eukaryotic environment for correct folding, disulfide bonding, and relevant glycosylation. However, the N-terminal 6xHis-Myc tag may sterically interfere with the protein's receptor-binding domains and functional conformation. While the full-length mature protein (28-192aa) contains all functional domains, the probability of correct folding with full bioactivity requires experimental validation due to potential tag interference.

1. Comparative Protein Structure and Function Studies

This application carries a significant risk without functional validation. EPO's structural and functional comparisons require native conformation and proper receptor-binding capability. If correctly folded and active (verified through receptor binding assays), the protein may enable valid comparative studies. If the tag interferes with folding/function (unverified), comparative analyses would yield misleading evolutionary and functional insights.

2. Antibody Development and Cross-Reactivity Testing

This application is highly suitable as antibody development relies on antigenic sequence recognition. The mammalian-expressed EPO provides proper folding and relevant glycosylation, making it an excellent immunogen. However, antibodies may primarily target the tags or may not recognize conformational epitopes if the tag alters protein structure.

3. Protein-Protein Interaction Studies

This application carries a high risk. EPO interactions with its receptor require precise tertiary structure. The tags may sterically hinder binding sites or create artificial interaction surfaces. If misfolded/unverified, pull-down assays may yield non-specific or tag-mediated artefacts rather than genuine physiological interactions.

4. In Vitro Assay Development and Validation

This application requires functional validation. Cell-based EPO assays depend on native receptor binding and signaling capability. If the tag compromises bioactivity (unverified), assay results will be biologically misleading. Dose-response studies may not reflect true potency if tagging reduces activity.

5. Immunogenicity and Safety Assessment Studies

This application carries significant limitations. The tags themselves are immunogenic and may dominate the immune response, making it difficult to assess EPO-specific immunogenicity. Results may not accurately predict the immunogenicity of native, tag-free EPO in clinical settings.

Final Recommendation & Action Plan

The mammalian-expressed EPO with N-terminal tags has a high probability of proper folding due to the appropriate expression system, but the tags may compromise bioactivity by interfering with receptor-binding domains. Begin with functional validation using receptor binding assays and cell-based proliferation tests before considering any functional applications. Application 2 (antibody development) can proceed with awareness of potential tag dominance. Applications 1, 3, and 4 require rigorous bioactivity validation. Application 5 has limited predictive value for native EPO immunogenicity. For reliable EPO research requiring native functionality, use tag-free EPO expressed in mammalian systems.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location
Secreted.
Protein Families
EPO/TPO family
Tissue Specificity
Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

UNIGENE: Mfa.5395

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products