Recombinant Macaca fascicularis Tissue factor (F3), partial (Active)

In Stock
Code: CSB-MP6582MOV
Size:
20ug
20ug100ug1mg
US$190
Quantity:
Express system: Mammalian cell
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cynomolgus monkey F3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/mL can bind Anti-F3 recombinant antibody (CSB-RA007928MA2HU). The EC50 is 0.4495-0.5538 ng/mL.
Target Names
F3
Uniprot NO.
Alternative Names
Tissue factor; Coagulation factor III; F3
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
33-252aa
Target Protein Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.4 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/ml can bind Anti-F3 recombinant antibody (CSB-RA007928MA2HU). The EC50 is 0.4495-0.5538 ng/mL.
Description

Tissue factor initiates the extrinsic coagulation cascade upon binding factor VIIa, making it a critical target for thrombosis research and anticoagulant therapeutic development. This cynomolgus macaque ortholog, spanning residues 33–252 to capture the complete extracellular domain, demonstrates quantifiable antibody-binding activity with an EC50 of 0.45–0.55 ng/mL in functional ELISA, confirming proper epitope presentation for therapeutic antibody screening and epitope mapping studies. Mammalian expression preserves the native glycosylation and disulfide architecture essential for physiologically relevant ligand interactions, supporting competitive inhibition assays and small-molecule inhibitor screening in drug discovery workflows. The protein meets the quality thresholds commonly required for surface plasmon resonance and biolayer interferometry affinity characterization, with purity exceeding 95% and endotoxin below 1.0 EU/μg, providing a suitable basis for binding kinetics studies and positive control applications in coagulation pathway investigations.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products