Abbreviation
Recombinant Cynomolgus monkey TNFRSF13B protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV). The EC50 is 7.254-13.83 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 11.13-18.97 ng/mL. ③Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 10.67-12.46 ng/mL. ④Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1-B). The EC50 is 0.6374-1.431 ng/mL.
Alternative Names
Tumor necrosis factor receptor superfamily member 13B; Transmembrane activator and CAML interactor; EGM_07468
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
2-160aa
Target Protein Sequence
SGLGRSRRGGRSRVDQEERSPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKAICNHQSQRTCATFCRSLNCRKEQGRFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGSEHRGSEASPALPGLKLSADQL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV). The EC50 is 7.254-13.83 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 11.13-18.97 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 10.67-12.46 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13B protein (CSB-MP897523HU1-B). The EC50 is 0.6374-1.431 ng/mL.
Description
TNFRSF13B (TACI) mediates B-cell survival and class-switch recombination by binding BAFF and APRIL, making it a critical node in humoral immunity and a target in autoimmune disease and B-cell malignancy research. This cynomolgus macaque ortholog, spanning residues 2–160 of the extracellular domain and produced in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantified binding to both cynomolgus TNFSF13B (EC50 7.3–13.8 ng/mL) and human TNFSF13 and TNFSF13B ligands (EC50 values ranging 0.64–19.0 ng/mL across isoforms), confirming cross-species receptor-ligand interaction fidelity suitable for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening in translational primate models. The low-picomolar to nanomolar EC50 range supports sensitive detection in ELISA-based ligand-binding studies and affinity characterization by surface plasmon resonance or biolayer interferometry. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% align with standards expected in functional immunoassays where cytokine contamination would confound B-cell activation readouts.
