Recombinant Macaca mulatta Interleukin-6 receptor subunit alpha (IL6R), Partial (Active)

CSB-MP5215MOW
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Macaca mulatta (Rhesus macaque)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/mL can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
②IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
IL6R
Uniprot NO.
Alternative Names
Interleukin-6 receptor subunit alpha; IL-6R 1
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
20-365aa
Target Protein Sequence
LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP
Mol. Weight
39.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/ml can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
  • Activity
    IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).
  • The purity of IL6R was greater than 90% as determined by SEC-HPLC

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products