Abbreviation
Recombinant Rhesus macaque IL6R protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/mL can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
②IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Interleukin-6 receptor subunit alpha; IL-6R 1
Species
Macaca mulatta (Rhesus macaque)
Expression Region
20-365aa
Target Protein Sequence
LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/ml can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
-
Activity
IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).
-
The purity of IL6R was greater than 90% as determined by SEC-HPLC
Description
IL-6 receptor alpha mediates the pleiotropic signaling of interleukin-6 in inflammation, immune regulation, and oncogenesis, making it a validated target for therapeutic intervention in cancer and autoimmune disease. This recombinant protein, spanning residues 20–365 and expressed in mammalian cells to preserve native glycosylation and folding, demonstrates robust binding to an anti-IL6R monoclonal antibody with a sub-nanomolar affinity constant of 0.381 nM as measured by surface plasmon resonance, confirming conformational integrity of the extracellular ligand-binding domain. Functional ELISA validation shows an EC50 of 26.59–31.72 ng/mL, providing quantitative benchmarks for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening workflows. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR-based affinity characterization, biolayer interferometry studies, and small-molecule inhibitor screening in drug discovery programs targeting IL-6 signaling pathways.
