Abbreviation
Recombinant Cynomolgus monkey TACSTD2 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/mL can bind Anti-TACSTD2 recombinant antibody（CSB-RA023072MA1HU） The EC50 is 2.103-2.767 ng/mL.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
31-274aa
Target Protein Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTASAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/ml can bind Anti-TACSTD2 recombinant antibody（CSB-RA023072MA1HU） The EC50 is 2.103-2.767 ng/mL.
Description
TACSTD2 plays a critical role in epithelial cell adhesion and has emerged as a therapeutic target in multiple carcinomas, making functional protein reagents essential for antibody development and mechanistic studies. This recombinant cynomolgus macaque TACSTD2 (aa 31–274) demonstrates specific antibody binding in functional ELISA with an EC50 of 2.103–2.767 ng/mL, confirming proper epitope presentation that supports antibody validation workflows and epitope mapping experiments. The yeast expression system yields protein exceeding 90% purity as determined by SDS-PAGE, with endotoxin levels below 1.0 EU/μg—criteria that align with standards expected in cell-based assays including adhesion studies and migration experiments where low endotoxin is critical for preserving cell viability and behavior. Researchers investigating tumor metastasis mechanisms or developing therapeutic antibodies against TACSTD2 can utilize this reagent for binding assays and functional characterization in a non-human primate model relevant to translational oncology research.
