Abbreviation
Recombinant Cynomolgus monkey TNFSF13B protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein. The EC50 is 7.254-13.83 ng/mL.
Alternative Names
TNF superfamily member 13b; TNFSF13B
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
141-285aa
Target Protein Sequence
TVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/ml can bind Macaca fascicularis TNFSF13B protein. The EC50 is 7.254-13.83 ng/mL.
Description
TNFSF13B (BAFF) regulates B-cell survival and maturation through TNFRSF13B (TACI) and related receptors, making it a critical target in autoimmunity and B-cell malignancy research. This cynomolgus macaque ortholog, spanning residues 141–285 of the mature extracellular domain, demonstrates robust receptor engagement with an EC50 of 7.3–13.8 ng/mL in functional ELISA against immobilized TNFRSF13B, providing a quantitative benchmark for dose selection in B-cell proliferation assays, NF-κB activation studies, and antibody class-switching experiments. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts in primary B-cell and PBMC cultures, where even trace contamination can confound cytokine-specific responses. Purity exceeding 90% by SDS-PAGE, combined with the validated receptor-binding activity, supports use as a positive control in ELISA-based cytokine detection platforms and as a reference standard for evaluating anti-BAFF therapeutic candidates in preclinical cynomolgus models of lupus or lymphoma.
