Abbreviation
Recombinant Cynomolgus monkey ACVRL1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC50 is 6.893-8.194 ng/mL.
Alternative Names
Serine/threonine-protein kinase receptor; EC:2.7.11.30; ACVRL1
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
22-118aa
Target Protein Sequence
DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/ml can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC50 is 6.893-8.194 ng/mL.
Description
ACVRL1, a type I receptor in the TGF-β superfamily, plays a critical role in angiogenesis and vascular remodeling, making it a target of interest in cancer research where aberrant signaling contributes to tumor vasculature development. This partial extracellular domain construct spanning residues 22–118 demonstrates quantifiable antibody-binding activity in functional ELISA, with an EC50 of 6.893–8.194 ng/mL when immobilized at 2 μg/mL and challenged with anti-ACVRL1 recombinant antibody, confirming proper epitope presentation. The validated binding kinetics support use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and ligand-receptor interaction assays including ELISA and surface plasmon resonance. Produced in baculovirus with greater than 95% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody development workflows and provides a suitable positive control for binding assays targeting the ACVRL1 extracellular region.
