Abbreviation
Recombinant Cynomolgus monkey PTH1R protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 1.072 to 1.403 ng/mL.
Alternative Names
Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; Parathyroid hormone 1 receptor; PTH1R
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
29-188aa
Target Protein Sequence
DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPANIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 1.072 to 1.403 ng/mL.
Description
PTH1R mediates the actions of parathyroid hormone and PTHrP in calcium homeostasis and bone remodeling, making its extracellular domain a critical target for therapeutic antibody development and ligand-binding studies. This cynomolgus monkey ortholog, spanning residues 29–188 of the N-terminal extracellular region, demonstrates quantifiable binding to an anti-PTH1R recombinant antibody with an EC50 of 1.072–1.403 ng/mL in functional ELISA, providing a validated basis for competitive inhibition assays, blocking antibody screening, and epitope mapping experiments. Mammalian cell expression preserves the native glycosylation and disulfide architecture essential for conformationally dependent antibody recognition, supporting its use in affinity characterization by surface plasmon resonance or biolayer interferometry. The protein meets purity thresholds exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, satisfying the quality criteria typical for ligand-receptor interaction studies and therapeutic antibody validation workflows in drug discovery programs targeting PTH1R signaling.