Abbreviation
Recombinant Cynomolgus monkey NECTIN2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis NECTIN2 at 2 μg/mL can bind Anti-NECTIN2 recombinant antibody(CSB-RA835690MA1HU). The EC50 is 1.011-1.193 ng/mL.
Alternative Names
Nectin cell adhesion molecule 2; NECTIN2
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
32-360aa
Target Protein Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSQRLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis NECTIN2 at 2 μg/ml can bind Anti-NECTIN2 recombinant antibody(CSB-RA835690MA1HU). The EC50 is 1.011-1.193 ng/mL.
-
The purity of NECTIN2 was greater than 95% as determined by SEC-HPLC
Description
NECTIN2 is a cell-adhesion molecule involved in cell-cell interactions, making its functional characterization critical for studying intercellular communication and adhesion-related signaling pathways. This recombinant Macaca fascicularis Nectin cell adhesion molecule 2 (NECTIN2), partial (Active) (CSB-MP5776MOV) is a mammalian cell-expressed protein spanning amino acids 32–360, featuring a C-terminal 10xHis-tag for purification and detection, with a molecular weight of 36.9 kDa. Functional activity is demonstrated by its binding ability in a functional ELISA, where immobilized Macaca fascicularis NECTIN2 at 2 μg/mL binds the Anti-NECTIN2 recombinant antibody (CSB-RA835690MA1HU) with an EC50 of 1.011–1.193 ng/mL, confirming specific interaction. Purity exceeds 95% as determined by both SDS-PAGE (Tris-Glycine discontinuous reduced gel with 5% enrichment and 15% separation) and SEC-HPLC, while endotoxin levels are below 1.0 EU/μg (measured by the LAL method). These attributes support its use in cell-adhesion mechanism studies, related signaling pathway investigations, antibody binding assays, and as a tool for exploring NECTIN2-mediated intercellular interactions. The high purity, low endotoxin, and His-tag facilitate reliable quantification and integration into various biochemical and cell-based workflows.
