Abbreviation
Recombinant Cynomolgus monkey FCGR3A protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC50 is 14.09-25.58 ng/ml.
Alternative Names
Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; Fc-gamma RIII-alpha (Fc-gamma RIII; Fc-gamma RIIIa; FcgammaRIIIa; CD16a; FCGR3A; FCGR3
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
17-208aa
Target Protein Sequence
GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC50 is 14.09-25.58 ng/ml.
Description
CD16a mediates antibody-dependent cellular cytotoxicity by bridging IgG-opsonized targets to NK cells and macrophages, making it a critical node in therapeutic antibody efficacy and immune surveillance studies. This cynomolgus macaque ortholog, spanning the extracellular domain (aa 17–208) and expressed in mammalian cells to preserve native glycosylation patterns, demonstrates quantifiable binding to an anti-FCGR3A antibody with an EC50 of 14.09–25.58 ng/ml in functional ELISA, confirming conformational integrity suitable for ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. The site-specific biotinylation via C-terminal Avi-tag enables direct immobilization in SPR and BLI platforms for affinity characterization of antibody-Fc variants or blocking candidates without compromising the receptor's binding interface. Purity exceeding 95% and endotoxin below 1.0 EU/μg align with standards expected in antibody-dependent cellular cytotoxicity mechanism studies and biologic inhibitor screening workflows.