Abbreviation
Recombinant Cynomolgus monkey GLP1R protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 1.292-1.518 ng/mL.
Alternative Names
Glucagon-like peptide 1 receptor; GLP1R
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
24-144aa
Target Protein Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GLP1R at 2 μg/ml can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 1.292-1.518 ng/mL.
Description
GLP-1 receptor signaling plays a central role in glucose homeostasis and cardiovascular protection, making the extracellular domain a critical target for therapeutic antibody development and small-molecule screening. This mammalian-expressed fragment spanning residues 24–144 captures the ligand-binding domain and demonstrates quantifiable antibody recognition in functional ELISA, with an EC50 of 1.292–1.518 ng/mL when binding a recombinant anti-GLP1R antibody at 2 μg/mL immobilization. The cynomolgus macaque ortholog enables direct translatability to preclinical primate models, supporting competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening where native glycosylation and disulfide architecture are essential for physiological binding kinetics. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in surface plasmon resonance affinity characterization and biolayer interferometry experiments requiring low background interference.
