Recombinant Macaca fascicularis Dipeptidase 3(DPEP3) (Active)

In Stock
Code: CSB-MP007125MOV
Size:
20ug
20ug100ug1mg
US$116
Quantity:
Express system: Mammalian cell
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cynomolgus monkey DPEP3 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU). The EC50 is 7.817-8.936 ng/mL.
Target Names
DPEP3
Uniprot NO.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
36-463aa
Target Protein Sequence
GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/ml can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU). The EC50 is 7.817-8.936 ng/mL.
Description

DPEP3 belongs to the membrane-bound dipeptidase family and has emerged as a target of interest in cancer metabolism research, where its role in peptide catabolism may influence tumor microenvironment dynamics. This full-length mature protein (aa 36–463) demonstrates specific antibody-binding activity with an EC50 of 7.817–8.936 ng/mL in functional ELISA, providing quantitative evidence that the recombinant construct retains native epitope presentation and supports its use as a positive control in immunoassays and as a reagent for inhibitor screening campaigns where consistent target recognition is essential. The C-terminal His tag placement preserves the N-terminal catalytic domain architecture, enabling researchers to conduct enzymatic activity assays, kinetic parameter analysis (Km, Vmax, kcat), and substrate specificity profiling without steric interference at the active site. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for accurate kinetic measurements, IC50 determination in drug candidate evaluation, and structural studies including crystallography where contaminant-free samples are critical for interpretable diffraction data.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Dipeptidase that hydrolyzes cystinyl-bis-glycine. Does not hydrolyzes leukotriene D4 (LTD4) into leukotriene E4 (LTE4).
Subcellular Location
Membrane; Lipid-anchor, GPI-anchor.
Protein Families
Metallo-dependent hydrolases superfamily, Peptidase M19 family
Database Links

UNIGENE: Mfa.6954

KEGG: mcf:102124306

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products