Abbreviation
Recombinant Cynomolgus monkey CRLF2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(CSB-MP5042MOVd7-B) at 2 μg/mL on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein. The EC50 is 2.698-3.710 ng/mL.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
23-231aa
Target Protein Sequence
QVATGEGLQIQIMYFNLETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAQQQDDILYFSIRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDTEWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGKTRDSCPEPRTPPKPKLSK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(CSB-MP5042MOVd7-B) at 2 μg/ml on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein. The EC50 is 2.698-3.710 ng/mL.
Description
CRLF2 forms a heterodimeric receptor complex with interleukin-7 receptor alpha (IL-7Rα) to mediate thymic stromal lymphopoietin (TSLP) signaling, a pathway central to allergic inflammation and lymphocyte development. This cynomolgus macaque ortholog, spanning the extracellular ligand-binding domain (aa 23–231), demonstrates quantifiable binding to recombinant TSLP in functional ELISA with an EC50 of 2.698–3.710 ng/mL, providing a validated basis for ligand-receptor interaction studies, competitive inhibition assays, and therapeutic antibody epitope mapping in translational immunology research. Mammalian cell expression preserves the native glycosylation and disulfide architecture required for physiologically relevant TSLP recognition, supporting its use in surface plasmon resonance and biolayer interferometry experiments to characterize binding kinetics of anti-CRLF2 biologics or small-molecule modulators. The protein meets purity (>95% by SDS-PAGE) and endotoxin (<1.0 EU/μg) thresholds typical for quantitative binding assays and serves as a positive control in screening campaigns targeting the TSLP–CRLF2–IL-7Rα axis in allergic disease models.
