Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), partial

Code: CSB-EP012147HU1
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human KEAP1 protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
KEAP1
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Cytosolic inhibitor of Nrf2;INrf2;Kelch-like protein 19
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
322-624aa
Target Protein Sequence
PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that regulates the response to oxidative stress by targeting NFE2L2/NRF2 for ubiquitination. KEAP1 acts as a key sensor of oxidative and electrophilic stress: in normal conditions, the BCR(KEAP1) complex mediates ubiquitination and degradation of NFE2L2/NRF2, a transcription factor regulating expression of many cytoprotective genes. In response to oxidative stress, different electrophile metabolites trigger non-enzymatic covalent modifications of highly reactive cysteine residues in KEAP1, leading to inactivate the ubiquitin ligase activity of the BCR(KEAP1) complex, promoting NFE2L2/NRF2 nuclear accumulation and expression of phase II detoxifying enzymes. In response to selective autophagy, KEAP1 is sequestered in inclusion bodies following its interaction with SQSTM1/p62, leading to inactivation of the BCR(KEAP1) complex and activation of NFE2L2/NRF2. The BCR(KEAP1) complex also mediates ubiquitination of SQSTM1/p62, increasing SQSTM1/p62 sequestering activity and degradation. The BCR(KEAP1) complex also targets BPTF and PGAM5 for ubiquitination and degradation by the proteasome.
Gene References into Functions
  1. KEAP1 acts as a cysteine thiol-rich sensor of redox insults. KEAP1 represses NRF2 activity under quiescent conditions, whereas NRF2 is liberated from KEAP1-mediated repression on exposure to stresses. [review] PMID:29717933
  2. the ability of porphyra-334 and shinorine to dissociate Nrf2 from Keap1 was confirmed also by measurement of increased mRNA expression of Nrf2 targeted genes encoding oxidative stress defense proteins in primary skin fibroblasts prior and post UVR exposure. PMID:30071261
  3. Aberrant Nrf2/Keap1 system integrity may affect self-defence mechanisms against oxidative stress in primary biliary cholangitis. PMID:28333129
  4. this study shows changes of KEAP1 expression levels induced by cell-free DNA in different cell types PMID:29743966
  5. Here we present a proof-of-concept application for the rational design of an epitope-specific antibody binding with the target protein Keap1, by grafting pre-defined structural interaction patterns from the native binding partner protein, Nrf2, onto geometrically matched positions of a set of antibody scaffolds. The designed antibodies bind to Keap1 and block the Keap1-Nrf2 interaction in an epitope-specific way PMID:28128368
  6. In the present review we briefly introduce the Nrf2-Keap1 system and describe Nrf2 functions, illustrate the Nrf2-NF-kappaB cross-talk, and highlight the effects of the Nrf2-Keap1 system in the physiology and pathophysiology of striated muscle tissue taking into account its role(s) in oxidative stress and reductive stress PMID:29499228
  7. Results show that KEAP1 expression in esophageal squamous cell carcinoma is regulated by miR-432-3p that binds directly its 3'UTR. PMID:28760781
  8. An intact complex of PGAM5-KEAP1-Nrf2 preserves mitochondrial motility by suppressing dominant-negative KEAP1 activity. PMID:28839075
  9. Hydrogen sulfide attenuates vascular smooth muscle cell calcification in vitro via the KEAP1-NRF2 redox sensing/stress response system by enhancing NQO1 expression. PMID:28865326
  10. Keap1 silencing in melanocytes induced melanogenesis and the expression of melanogenesis-associated molecules through HO-1-associated beta-catenin activation. Keap1 downregulation in melanocytes is important for cell proliferation and survival. PMID:28583303
  11. itaconate alkylates cysteine residues 151, 257, 288, 273 and 297 on the protein KEAP1, enabling Nrf2 to increase the expression of downstream genes with anti-oxidant and anti-inflammatory capacities PMID:29590092
  12. results demonstrate a multifaceted protective potential of KEAP1-NRF2 signaling in key cell types relevant to Huntington disease pathology PMID:28533375
  13. Curcumin Protects Skin against UVB-Induced Cytotoxicity via the Keap1-Nrf2 Pathway: The Use of a Microemulsion Delivery System. PMID:28757910
  14. The research demonstrated that Keap1 should be a promising E3 ligase adaptor to be used in the design of novel PROTACs. PMID:29407955
  15. High cytoplasmic Keap1 expression, which might prevent nuclear translocation of Nrf2 in ovarian cancer cells, was associated with lower disease recurrence and death rate. PMID:28129239
  16. The ratio of thioredoxin/Keap1 protein level may be useful for suggesting distant metastasis in colorectal cancer. PMID:29053012
  17. our study pinpoints that PAQR3 functions as an adaptor protein to promote Nrf2-Keap1 complex formation, thereby modulating the Nrf2-Keap2 pathway and playing an important role in controlling antioxidant response of the cell PMID:27212020
  18. provide a rationale for stratification of human patients with lung cancer harboring KRAS/KEAP1- or KRAS/NRF2-mutant lung tumors as likely to respond to glutaminase inhibition PMID:28967920
  19. Our results identified ECG as a novel Keap1-Nrf2 interaction disruptor and LPS-induced TLR4 activation inhibitor, thereby providing an innovative strategy to prevent or treat immune, oxidative stress and inflammatory-related diseases PMID:26878775
  20. The Keap-1/Nrf2 redox system is a biological target of SSNO. PMID:27663261
  21. Molecular docking studies revealed that Wogonin can disrupt KEAP-1/Nrf-2 interaction by directly blocking the binding site of Nrf-2 in the KEAP-1 protein. The study provides novel insights into the development of Nrf2 as a promising candidate and Wogonin as a therapeutic agent for the management of Osteoarthritis . PMID:28237856
  22. Data show that genistein induced re-expression of the methylated Keap1 genes through demethylation in A549 cells, however, no Keap1 mRNA expression changes were detected in MRC-5 fibroblast cells. PMID:27029077
  23. Punicalagin protects HepG2 cells from lipotoxicity induced by free fatty acids through activating Nrf2/Keap1 pathway. PMID:26989875
  24. Data suggest that Keap1, rather than Nrf2, is critical for the recruitment of iASPP into the Keap1-Nrf2 complex PMID:29033244
  25. The modification of NRF2 or KEAP1 expression in non-small cell lung cancer cell lines disrupted downstream gene expression and cell sensitivity to platinum-based drugs. PMID:27601007
  26. These data demonstrate that the beneficial properties of SFN extend beyond activation of the KEAP1-Nrf2-ARE system and warrant further interrogation given the current use of this agent in multiple clinical trials PMID:27889639
  27. Result showed that there was a significant association between Keap1 and phosphorylated (p) Nrf2 expression in hepatocellular carcinoma. Higher pNrf2 expression was more likely observed in those specimens with reduced Keap1 expression. PMID:27650414
  28. Results provide evidence for a critical role of mutations in TP53 and KEAP1 during lung squamous cell carcinoma (LSCC oncogenesis, because deletion of either gene leads to increased self-renewal of airway basal stem cells. Also, KEAP1/NRF2 mutations increase radioresistance and predict local tumor recurrence in radiotherapy treated LSCC patients. PMID:27663899
  29. Study showed that Sequestosome 1-mediated sequestration of Keap1 is associated with chronic activation of the Nrf2 stress response pathway in the autophagic vacuolar myopathie muscle; demonstrated that Nrf2 signaling is upregulated in autophagic muscle disorders and raise the possibility that autophagy disruption in skeletal muscle leads to dysregulation of cellular redox homeostasis. PMID:27799074
  30. Keap1 (Kelch-like ECH-associated protein 1) is an adaptor subunit of Cullin 3-based E3 ubiquitin ligase. Keap1 regulates the activity of Nrf2 and acts as a sensor for oxidative and electrophilic stresses. PMID:28842501
  31. NRF2 is regulated at protein level by proteasomal degradation via KEAP1. Data suggest that antioxidant-induced up-regulation of NRF2 expression (a) overcomes KEAP1 regulation, (b) activates NRF2 translocation to nucleus, and (c) activates antioxidant response element. (NRF2 = nuclear factor [erythroid-derived 2]-like 2 protein; KEAP1 = Kelch-like ECH-associated protein 1) PMID:28684421
  32. Results indicate that microRNA miR-141 targets kelch like ECH associated protein 1 (Keap1) to activate NF-E2-related factor 2 (Nrf2) signaling, which protects retinal pigment epithelium cells (RPEs) and retinal ganglion cells (RGCs) from UV radiation. PMID:28061435
  33. Data indicate the role of kelch like ECH associated protein 1 (Keap1)/nuclear factor E2-related factor 2 (Nrf2) axis deregulation with potential new function as independent epigenetic prognostic marker in renal cell carcinoma. PMID:28061437
  34. clinical cholangiocarcinoma samples displayed FoxO3-Keap1 down-regulation and Nrf2 hyperactivation PMID:26857210
  35. the dual role of nuclear factor-erythroid 2 signaling in induction of colorectal cancer cell survival and death as well as the possibility of targeting nuclear factor-erythroid 2-kelch-like ECH-associated protein 1 axis as an advanced strategy in prevention and effective treatment of colorectal cancer patients have been discussed. PMID:28621229
  36. Using a combination of biochemical and mass spectrometry studies, the authors show that VP24 is a dimer in solution that directly binds to the Kelch domain of Kelch-like ECH-associated protein 1 (Keap1) to regulate nuclear factor (erythroid-derived 2)-like 2 (Nrf2). PMID:27497688
  37. These data establish new functions for KEAP1 within the nucleus and identify MCM3 as a novel substrate of the KEAP1-CUL3-RBX1 E3 ligase. PMID:27621311
  38. ur results identify WDR23 as an alternative regulator of NRF2 proteostasis and uncover a cellular pathway that regulates NRF2 activity and capacity for cytoprotection independently of KEAP1. PMID:28453520
  39. Keap1 orchestrates the antioxidant response; the system can be targeted for therapy [review] PMID:27769838
  40. Keap1 is the main negative regulator of Nrf2 [review] PMID:27497696
  41. Results show that GSTP potentiates S-glutathionylation of Keap1, which leads to Nrf2 activation and subsequently increases expression of GSTP. This positive feedback regulatory loop represents a novel mechanism by which GSTP elicits antioxidant protection in the brain. PMID:27086966
  42. EMT signalling and the KEAP1/NFE2L2-axis are likely to be involved in metastatic spread of malignant melanoma and also appear to have potential interactions. PMID:27170270
  43. the expression of NRF2, KEAP1, NQO-1 and HO-1 are increased significantly in advanced laryngeal squamous cell carcinoma, compared with the adjacent normal mucosa. Remarkable relevance exists between high expression of KEAP1, NQO-1, HO-1 and nuclear NRF2. their expression levels were independent of age, tumor stage (clinical stage III and IV), tumor size and lymph node metastasis. PMID:27840932
  44. miR-200a was found to interact with the 3'-untranslated region of Keap1, the native regulator of Nrf2. PMID:27573160
  45. We present the case that chemoprevention through the Keap1/Nrf2 system may be context dependent and that the Nrf2 "dose-response curve" for electrophilic and redox balance may not be monotonic. PMID:27806574
  46. Immunohistochemical assays were used to measure the expression of Keap1 protein in breast cancer tissue and adjacent normal tissue, and its clinical significance was explored. We observed that 24.6% breast cancer tissue samples were positive for Keap1, a significantly lower proportion than that seen with adjacent normal tissue specimens PMID:27323010
  47. c-myc plays a key role in MBD1 mediated epigenetic silencing of KEAP1. PMID:26980696
  48. Results show up-regulation of TrkB and down-regulation of Runx3 and Keap1 in breast cancer cells and suggest that TrkB plays a key role in tumorigenicity and metastasis of breast cancer cells through suppression of Runx3 or Keap1. PMID:26657794
  49. Inhibition of NRF2 by KEAP1 overexpression compromises metabolic reprogramming of fibroblasts and results in reduced efficiency of induced pluripotent stem cells colony formation. PMID:26904936
  50. Induction of GSH-related genes xCT and GCLM were oxygen and Bach1-insensitive during long-term culture under 5% O2, providing the first evidence that genes related to GSH synthesis mediate protection afforded by Nrf2-Keap1 defense pathway PMID:26698668

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Broadly expressed, with highest levels in skeletal muscle.
Database Links

HGNC: 23177

UNIGENE: Hs.465870

KEGG: hsa:9817

STRING: 9606.ENSP00000171111

OMIM: 606016

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products