Recombinant Human cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)

Code: CSB-EP018688HUe2
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal Flag-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human PRKACA protein
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
PRKACA
Uniprot NO.
Research Area
Cancer
Alternative Names
PKA C-alpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-351aa
Target Protein Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Phosphorylates a large number of substrates in the cytoplasm and the nucleus. Phosphorylates CDC25B, ABL1, NFKB1, CLDN3, PSMC5/RPT6, PJA2, RYR2, RORA, SOX9 and VASP. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. RORA is activated by phosphorylation. Required for glucose-mediated adipogenic differentiation increase and osteogenic differentiation inhibition from osteoblasts. Involved in chondrogenesis by mediating phosphorylation of SOX9. Involved in the regulation of platelets in response to thrombin and collagen; maintains circulating platelets in a resting state by phosphorylating proteins in numerous platelet inhibitory pathways when in complex with NF-kappa-B (NFKB1 and NFKB2) and I-kappa-B-alpha (NFKBIA), but thrombin and collagen disrupt these complexes and free active PRKACA stimulates platelets and leads to platelet aggregation by phosphorylating VASP. Prevents the antiproliferative and anti-invasive effects of alpha-difluoromethylornithine in breast cancer cells when activated. RYR2 channel activity is potentiated by phosphorylation in presence of luminal Ca(2+), leading to reduced amplitude and increased frequency of store overload-induced Ca(2+) release (SOICR) characterized by an increased rate of Ca(2+) release and propagation velocity of spontaneous Ca(2+) waves, despite reduced wave amplitude and resting cytosolic Ca(2+). PSMC5/RPT6 activation by phosphorylation stimulates proteasome. Negatively regulates tight junctions (TJs) in ovarian cancer cells via CLDN3 phosphorylation. NFKB1 phosphorylation promotes NF-kappa-B p50-p50 DNA binding. Involved in embryonic development by down-regulating the Hedgehog (Hh) signaling pathway that determines embryo pattern formation and morphogenesis. Prevents meiosis resumption in prophase-arrested oocytes via CDC25B inactivation by phosphorylation. May also regulate rapid eye movement (REM) sleep in the pedunculopontine tegmental (PPT). Phosphorylates APOBEC3G and AICDA. Phosphorylates HSF1; this phosphorylation promotes HSF1 nuclear localization and transcriptional activity upon heat shock.; Phosphorylates and activates ABL1 in sperm flagellum to promote spermatozoa capacitation.
Gene References into Functions
  1. Ezrin-anchored PKA phosphorylates serine 369 and 373 on connexin 43 to enhance gap junction assembly, communication, and cell fusion. PMID:29259079
  2. CaV1.4 channels are indeed modulated by PKA phosphorylation within the inhibitor of Ca(2+)-dependent inactivation (ICDI) motif. PMID:27456671
  3. In this study, the authors linked for the first time the loss of RIIbeta protein levels to the PRKACA mutation status and found the down-regulation of RIIbeta to arise post-transcriptionally. PMID:28250426
  4. the presence of lipofuscin in cortisol-producing adenomas (CPAs) responsible for Cushing syndrome with and without the PRKACA (pLeu206Arg) somatic mutation, was investigated. PMID:28834963
  5. Mechanistically, Sirt1 expression elevates phosphorylation of the alpha subunit of protein kinase A (PKA alpha), and this event is essential for Sirt1-induced phosphorylation of beta Catenin. PMID:28583374
  6. PKA, under the conditions of experimental approach appears to function as a master upstream kinase that is sufficient to initiate the complex pattern of intracellular signaling pathway and gene expression profiles that accompany ovarian granulosa cells differentiation PMID:27324437
  7. CTR activates AKAP2-anchored cAMP-dependent protein kinase A, which then phosphorylates tight junction proteins ZO-1 and claudin 3. PMID:28428082
  8. These results indicate that Mixed fibrolamellar hepatocellular carcinoma (mFL-HCC) is similar to pure FL-HCC at the genomic level and the DNAJB1:PRKACA fusion can be used as a diagnostic tool for both pure and mFL-HCC PMID:27029710
  9. PRKACA mutations are highly specific for cortisol over-secretion, while they are absent or very rare in the context of other adrenal diseases. Patients carrying these somatic mutations are affected by a more severe phenotype and are identified at a younger age. PMID:27871112
  10. Somatic mutations in PRKACA, coding for the catalytic alpha subunit of protein kinase A (PKA), have been recently identified as the most frequent genetic alteration in cortisol-secreting adrenocortical adenomas, which are responsible for adrenal Cushing's syndrome. PMID:27813054
  11. HIF1a transcriptional activity is stimulated by Protein kinase A-dependent phosphorylation PMID:27245613
  12. cigarette smoke extracts activate the PKA, CREB, and IL-13Ralpha2 axis in lung endothelial cells. PMID:27986643
  13. Data indicate a subpopulation of the CaV1.2 channel pore-forming subunit (alpha1C) within nanometer proximity of protein kinase A (PKA) at the sarcolemma of murine and human arterial myocytes. PMID:28119464
  14. we propose that the PKA-Smurf1-PIPKIgamma pathway has an important role in pulmonary tumorigenesis and imposes substantial clinical impact on development of novel diagnostic markers and therapeutic targets for lung cancer treatment. PMID:28581524
  15. cAMP/PKA signaling attenuated respiratory syncytial virus-induced disruption of structure and functions of the model airway epithelial barrier by mechanisms involving the stabilization of epithelial junctions and inhibition of viral biogenesis PMID:28759570
  16. The mutated PRKACA proteins lost their ability to bind to PRKAR1A, and thereby lead to constitutive activation of the PKA pathway. Together with previous reports of PRKAR1A mutations in syndromic cardiac myxoma, our study demonstrates the importance of the PKA pathway in the tumourigenesis of cardiac myxoma. PMID:28369983
  17. differential regulation of PKA and cell stiffness in unconfined versus confined cells is abrogated by dual, but not individual, inhibition of Piezo1 and myosin II. PMID:27160899
  18. Data show that the adenylate cyclase (AC) pathway as genes relating to the antitumor activity of xanthohumol (XN) against tumor cells, and the pathway regulates various cellular functions via activating protein kinase A (PKA)-dependent phosphorylation. PMID:28122154
  19. PRKACA mutations are present in cortisol-producing adenomas and bilateral adrenal macronodular hyperplasia. PRKACA mutation is associated with more severe autonomous cortisol secretion. PMID:27296931
  20. Dual co-expression of human fetal Tau with PKA in Escherichia coli results in multisite Tau phosphorylation including also naturally occurring sites which were not previously considered in the context of 14-3-3 binding. Tau protein co-expressed with PKA displays tight functional interaction with 14-3-3 isoforms of a different type. PMID:28575131
  21. This review will discuss the effects of PKA phosphorylation on wild-type CFTR, the consequences of cystic fibrosis mutations on PKA phosphorylation, and the development of therapies that target PKA-mediated signaling. [review] PMID:27722768
  22. This interaction is promoted by EPAC1 activation, triggering its translocation to the plasma membrane and binding to NHERF1. Our findings identify a new CFTR-interacting protein and demonstrate that cAMP activates CFTR through two different but complementary pathways - the well-known PKA-dependent channel gating pathway and a new mechanism regulating endocytosis that involves EPAC1. PMID:27206858
  23. The inhibitory effects of BMP4 on PDGF-induced cell proliferation, collagen synthesis, and calpain-2 activation are impaired in pulmonary artery smooth muscle cells from pulmonary arterial hypertension patient. PMID:28235949
  24. immunohistochemical staining for StAR is a reliable pathological approach for the diagnosis and classification of adrenocortical adenomas with cAMP/PKA signaling-activating mutations. PMID:27606678
  25. description of PRKACA mutations in 2 cases of primary aldosteronism (PA) patients: a novel variant (p.His88Asp) in a case of sudden onset of PA and a mutation (p.Leu206Arg) in context of hypokalemic aggravation of long-term hypertension; these genetic alterations were not found in a subsequent series of 120 aldosterone-producing adenomas and thereby appear to be very rare events PMID:27270477
  26. PKA signaling is pivotal in pigmentation process itself in cultured melanoma cells, while the importance of Wnt/beta-catenin signaling should be emphasized in the context of development and differentiation PMID:27567978
  27. Studies indicate a functional interaction between leucine-rich repeat kinase 2 (LRRK2) and protein kinase A (PKA) cross-talk in neuron and microglia. PMID:28202680
  28. Studies indicate the 3'-5'-Cyclic adenosine monophosphate/protein kinase A (cAMP/PKA) signalling pathway at distinct mitochondria subdomains represented by the outer and inner mitochondrial membranes. PMID:28202681
  29. CKbeta phosphorylation by MCF-7 cell lysate was inhibited by a PKA-specific inhibitor peptide, and the intracellular phosphorylation of CKbeta was shown to be regulated by the level of cyclic adenosine monophosphate (cAMP), a PKA activator PMID:27149373
  30. GPER enhances melanogenesis via PKA by upregulating microphthalmia-related transcription factor-tyrosinase in melanoma PMID:27378491
  31. testosterone rapidly increased whole-cell HCAEC SKCa and BKCa currents via a surface androgen receptor, Gi/o protein, and protein kinase A PMID:28223151
  32. PRKACA mutation is associated with Adrenocortical Adenomas. PMID:27389594
  33. Differentiation of mesenchymal stem cells into beige/brown adipocytes can be related via PKA modulation. PMID:27498007
  34. FL-HCCs in children and young adults uniquely overexpress DNAJB1-PRKACA, which results in elevated cAMP-dependent PKA activity PMID:27027723
  35. high-resolution models for PKA(WT) and PKA(L)(205R) substrate specificity. PMID:28100013
  36. CFTR inhibition also affected cAMP/PKA-downstream events such as the increase in tyrosine phosphorylation, hyperactivated motility, and acrosome reaction. PMID:27714810
  37. Results suggest that G protein alpha S subunit (Galphas) plays a tumor-promoting role in renal cell carcinoma (RCC) and possibly acts through a protein kinase A (PKA)-dependent pathway. PMID:28051330
  38. Phosphorylation of ezrin together with its binding to phosphatidylinositol-4,5-bisphosphate tethers the F508del CFTR to the actin cytoskeleton, stabilizing it on the apical membrane and rescuing the sub-membrane compartmentalization of cAMP and activated PKA. PMID:26823603
  39. Data show that activated PKA phosphorylates the 19S subunit, Rpn6/PSMD11 (regulatory particle non-ATPase 6/proteasome subunit D11) at Ser14. PMID:26669444
  40. Our results reveal for the first time the role of the versatile PKA in cancer cells survival under chronic glucose starvation and anoikis and may be a novel potential target for cancer treatment. PMID:26978032
  41. PKA phosphorylates the ATPase inhibitory factor 1 and inactivates its capacity to bind and inhibit the mitochondrial H(+)-ATP synthase. PMID:26387949
  42. DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target PMID:26505878
  43. No somatic mutations were observed in PRKACA in a cohort of GH-secreting pituitary adenomas. PMID:26701869
  44. Protein kinase A activity is necessary for fission and fusion of Golgi to endoplasmic reticulum retrograde tubules. PMID:26258546
  45. Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity. PMID:26052940
  46. ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase. PMID:25951193
  47. Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation. PMID:26435498
  48. Data indicate that protein kinase A (PKA) phosphorylates only serine-253 amino acid on activator of G-protein signaling 1 protein Dexras1 (RASD1). PMID:26358293
  49. PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation. PMID:25188285
  50. Leu206Arg and Leu199_Cys200insTrp mutations in PRKACA impair its association with PRKAR2B and PRKAR1A. PMID:25477193

Show More

Hide All

Subcellular Location
Cytoplasm. Cell membrane. Nucleus. Mitochondrion. Membrane; Lipid-anchor.; [Isoform 2]: Cell projection, cilium, flagellum. Cytoplasmic vesicle, secretory vesicle, acrosome.
Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
Tissue Specificity
Isoform 1 is ubiquitous. Isoform 2 is sperm-specific and is enriched in pachytene spermatocytes but is not detected in round spermatids.
Database Links

HGNC: 9380

UNIGENE: Hs.631630

KEGG: hsa:5566

STRING: 9606.ENSP00000309591

OMIM: 601639

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products