Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
Gli 1; GLI; GLI family zinc finger 1; GLI Kruppel family member 1; gli1; GLI1_HUMAN; Glioma associated oncogene 1; Glioma associated oncogene homolog 1 (zinc finger protein) ; Glioma associated oncogene homolog; Glioma-associated oncogene; Oncogene GLI; Zfp 5; Zfp5; Zinc finger protein GLI 1; Zinc finger protein GLI1
Species
Homo sapiens (Human)
Expression Region
921-1106aa
Target Protein Sequence
QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 921-1106 form the expressed segment for recombinant Human GLI1. The expected molecular weight for the GLI1 protein is calculated to be 23.3 kDa. Expression of this GLI1 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of GLI1, making it easier to detect and purify the GLI1 recombinant protein in the later stages of expression and purification.
The human Zinc finger protein GLI1 is a transcription factor and a key mediator of the Hedgehog signaling pathway. GLI1 plays a critical role in various developmental processes and cell fate determination. GLI1 contains zinc finger DNA-binding domains and acts downstream of Hedgehog ligands. When the Hedgehog pathway is activated, GLI1 translocates to the nucleus, where it regulates the expression of target genes involved in cell proliferation, differentiation, and survival. Dysregulation of GLI1 is associated with various cancers, making it a potential target for cancer therapeutics. Research on Zinc finger protein GLI1 focuses on understanding its precise roles in development, tissue homeostasis, and its implications in cancer progression.
