Recombinant Human Transcriptional coactivator YAP1 (YAP1)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
YAP1
Uniprot NO.
Research Area
Cancer
Alternative Names
65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP-1; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
1-504aa
Target Protein Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.4kD
Protein Length
Full length
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role in controlling cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Suppresses ciliogenesis via acting as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1. In conjunction with WWTR1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation.; Activates the C-terminal fragment (CTF) of ERBB4 (isoform 3).; Activates the C-terminal fragment (CTF) of ERBB4 (isoform 3).
Gene References into Functions
  1. Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape. PMID:22895435
  2. loss of p53 or LKB1 relieves DVL-linked reciprocal inhibition between the Wnt and nuclear YAP activity PMID:29895829
  3. that lncRNA B4GALT1-AS1 promotes OS cells stemness and migration via recruiting HuR to enhance YAP activity PMID:30182452
  4. The miR-590-5p/YAP axis may be an important novel mechanism in the pathogenesis of CD and colorectal cancer. PMID:29912317
  5. The observed decrease in total YAP levels in endothelial cells exposed to pulsatile flow is due to degradation via a proteasome-independent mechanism. PMID:29758328
  6. disruption of TAZ/YAP activity alleviates tumor burden in Lats1/2-deficient mice and inhibits human malignant peripheral nerve sheath tumors cell proliferation PMID:29438698
  7. Molecular mechanisms of YAP protein in the lung physiological conditions and lung diseases.[review] PMID:30385178
  8. Report that YAP is subject to non-proteolytic, K63-linked polyubiquitination by the SCF(SKP2) E3 ligase complex (SKP2), which is reversed by the deubiquitinase OTUD1. The non-proteolytic ubiquitination of YAP enhances its interaction with its nuclear binding partner TEAD, thereby inducing YAP's nuclear localization, transcriptional activity, and growth-promoting function. PMID:29891922
  9. Dual governing of YAP and COX-2 may lead to the discovery of promising therapeutic strategies for HCC patients. PMID:29505957
  10. YAP messenger RNA (mRNA) and protein expression levels were less in preeclamptic placentas. Yes-associated protein enhanced cell invasion, reduced the cellular apoptotic response, and had no effect on proliferation. PMID:29303055
  11. Study indicated that lncRNAATB functions as a ceRNA to promote MM proliferation and invasion by enhancing Yes associated protein 1 expression by competitively sponging microRNA miR5905p. PMID:29956757
  12. O-GlcNAcylation of YAP was required for high-glucose-induced liver tumorigenesis. PMID:28474680
  13. These results unveil a novel mechanism of YAP activation in cancer and open the possibility to target GR to prevent cancer stem cells self-renewal and chemoresistance. PMID:28102225
  14. High YAP1 expression is associated with the pathogenesis of gastric cancer. PMID:30066917
  15. YAP1 as a fluid mechanosensor that functions to regulate genes that promote metastasis. PMID:28098159
  16. These observations revealed the importance of YAP in promoting TKI-resistance and combined YAP inhibition can be a potential therapy delaying the occurrence of TKI-resistance in lung adenocarcinoma. PMID:29321482
  17. High Yap expression is associated with resistance to EGFR inhibitors in colorectal cancer. PMID:30106444
  18. High YAP1 expression is associated with malignant melanoma. PMID:30106445
  19. Data (including data from studies in knockout mice) suggest that KIBRA plays important role in regulating HPO activity, YAP signaling, and actin cytoskeletal dynamics in podocytes; expression of KIBRA and YAP plus phosphorylation of YAP are up-regulated in glomeruli of patients with focal segmental glomerulosclerosis. (KIBRA = kidney/brain protein-KIBRA; HPO = hepatopoietin protein; YAP = Yes associated protein-1) PMID:28982981
  20. YAP/TAZ mechanotransduction integrates with cell-cell communication pathways for fine-grained orchestration of stem cell decisions. PMID:28513598
  21. YAP1 regulates the SOX2 expression in urothelial carcinoma of the bladder.COX2 and YAP1 signaling pathways are connected with each other to induce SOX2 expression, cancer stem cell enrichment, and acquired resistance to chemotherapy in urothelial carcinoma of the bladder. PMID:29180467
  22. our study showed for the first time that MLK7-AS1 interacted with miR-375 to promote proliferation, metastasis, and EMT process in ovarian cancer cells through upregulating YAP1. PMID:30249278
  23. Loss of DLG5 expression promoted breast cancer progression by inactivating the Hippo signaling pathway and increasing nuclear YAP. PMID:28169360
  24. YAP enhances gastric cancer cell proliferation. PMID:30021363
  25. miR-205 targets YAP1 and inhibits proliferation and invasion of thyroid cancer cells. PMID:29845281
  26. FAK controls the nuclear translocation and activation of YAP in response to mechanical activation and submit that the YAP-dependent process of durotaxis requires a cell with an asymmetric distribution of active and inactive FAK molecules. PMID:29070586
  27. the tumor promoting role of YAP is involved in SHP2 which functions as a tumor promoter in vitro but as a tumor suppressor in vivo PMID:29699904
  28. The combined treatment significantly sensitized the A549/DDP cells to DDPinduced growth inhibition by reducing YAP promoter activity. PMID:29901163
  29. These results reveal a novel positive feedback loop involving CD44S and YAP1, in which CD44S functions as both an upstream regulator and a downstream effector of YAP1 in hepatocellular carcinoma. PMID:29649630
  30. hypoxic stress in the hepatocellular carcinoma (HCC)cells promoted YAP binding to HIF-1a in the nucleus and sustained HIF-1a protein stability to bind to PKM2 gene and directly activates PKM2 transcription to accelerate glycolysis PMID:30180863
  31. PTEN lipid phosphatase inactivation abolished the MOB1-LATS1/2 interaction, decreased YAP phosphorylation and finally promoted YAP nuclear translocation, which enhanced the synergistic effect of YAP-TEAD, thus inducing cell proliferation and migration. PMID:30134988
  32. Up-regulation of COPB2 inhibited cell apoptosis and promoted cell growth and tumorigenesis through up-regulating YAP1 expression in lung adenocarcinoma. PMID:29674272
  33. In the present review, we focus on the functions of YAP/TAZ in cancer, discuss their potential as new therapeutic target for tumor treatment, and provide valuable suggestions for further study in this field. PMID:29749524
  34. HuR acts as a tumor promoter by enhancing YAP expression in osteosarcoma cells. PMID:29597092
  35. These results indicate a negative link between miR-622 and YAP1 and further confirm that YAP1 is a direct target of miR-622, suggesting that miR-622 could be a new important therapeutic strategy for gliomas treatment. PMID:28796324
  36. YAP1 and LATS1 can be considered as new prognostic factors in clear cell renal cell carcinoma. PMID:29850494
  37. Yap1 expression in aggressive thyroid cancer. PMID:28120182
  38. These results suggested that silibinin induced glioblastoma cell apoptosis concomitant with autophagy which might be due to simultaneous inhibition of mTOR and YAP and silibinin induced autophagy exerted a protective role against cell apoptosis in both A172 and SR cells. PMID:29780826
  39. these observations suggest that Zyxin promotes colon cancer tumorigenesis in a mitotic-phosphorylation-dependent manner and through CDK8-mediated YAP activation. PMID:29967145
  40. we discover that Verteporfin (VP) inhibits YAP-induced bladder cancer cell growth and invasion via repressing the target genes' expression of Hippo signaling pathway. PMID:29725256
  41. Myeloid Zinc Finger 1 and GA Binding Protein Co-Operate with Sox2 in Regulating the Expression of Yes-Associated Protein 1 in Cancer Cells PMID:28905448
  42. lncBRM and YAP1 signalling may serve as biomarkers for diagnosis and potential drug targets for hepatocellular carcinoma. PMID:27905400
  43. lncARSR interacts with Yes-associated protein (YAP) to block its phosphorylation by LATS1, facilitating YAP nuclear translocation. PMID:27886176
  44. YAP contributes to glioma cell migration and invasion by regulating N-cadherin and Twist, as well as cytoskeletal reorganization. PMID:29306996
  45. LIFR attenuates tumor metastasis by suppressing YAP expression, suggesting that LIFR may serve as a potential target for clear cell renal cell carcinoma treatment. PMID:29902078
  46. Serine/threonine-protein kinase proteins, also known as P21-activated kinase (PAK), and the mechanosensitive factor, Yes-associated protein 1 (YAP-1) are core mediators of pro-fibrotic integrin beta-1 signaling. PMID:27535340
  47. The gene transcription and protein expression of YAP may be involved in the development of prostate cancer and may be considered a potential target for the treatment of such cancers. PMID:29286134
  48. Upregulated miR-200a enhances treatment resistance via antagonizing TP53INP1 and YAP1 in breast cancer. PMID:29329575
  49. Bioinformatics analysis and luciferase reporter assays indicated that miR625 targeted the 3'untranslated region of Yesassociated protein 1 (YAP1). PMID:29257207
  50. functional evaluation of a HTM cell monolayer using a permeability assay demonstrated that the inhibition of YAP and TAZ attenuated the DEX-induced impairment of permeability. These findings suggest that YAP and TAZ play pivotal roles in the DEX-induced cytoskeletal changes of HTM cells, and reveal novel potential mechanisms for the development and progression of glaucoma PMID:29115373

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
YAP1 family
Tissue Specificity
Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).
Database Links

HGNC: 16262

UNIGENE: Hs.503692

KEGG: hsa:10413

STRING: 9606.ENSP00000282441

OMIM: 120433

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1