Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
DBP; DBP/GC; GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB; VDBG; VDBP; Vitamin D binding alpha globulin; Vitamin D-binding protein; VTDB_HUMAN
Species
Homo sapiens (Human)
Expression Region
19-474aa
Target Protein Sequence
RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene responsible for the Human Vitamin D-binding protein (19-474aa) is incorporated into a plasmid vector, forming recombinant plasmid. The resulting recombinant plasmid is introduced into e.coli cells, from which cells survive in the presence of a specific antibiotic are selected. The selected e.coli cells containing the recombinant plasmid are cultured under conditions that facilitate the expression of the gene of interest. A N-terminal 6xHis tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human Vitamin D-binding protein from the cell lysate. Denaturing SDS-PAGE is employed to resolve the resulting recombinant Human Vitamin D-binding protein, revealing a purity greater than 90%.
