Abbreviation
Recombinant Human VEGFA protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human VEGFA protein at 2 μg/mL can bind Anti-VEGFA recombinant antibody (CSB-RA025833MA2HU). The EC50 is 0.6797-0.8382 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/mL can bind Human VEGFA protein. The EC50 is 28.72-33.22 ng/mL.
Alternative Names
Vascular endothelial growth factor A, long form; L-VEGF; Vascular permeability factor (VPF); VEGFA; VEGF
Species
Homo sapiens (Human)
Expression Region
27-191aa
Target Protein Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein of Isoform VEGF165
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human VEGFA protein at 2 μg/ml can bind Anti-VEGFA recombinant antibody (CSB-RA025833MA2HU). The EC50 is 0.6797-0.8382 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/ml can bind Human VEGFA protein. The EC50 is 28.72-33.22 ng/mL.
Description
VEGF165, the predominant pro-angiogenic isoform in human physiology, drives endothelial cell proliferation and vascular permeability through high-affinity receptor engagement, making quantitative assessment of its binding kinetics essential for angiogenesis research and antibody development. This mammalian-expressed protein spanning residues 27–191 demonstrates robust receptor interaction, binding immobilized FLT1 (VEGFR-1) with an EC50 of 28.72–33.22 ng/mL in functional ELISA, a result that supports its use in receptor-ligand competition assays, surface plasmon resonance studies, and cell-based angiogenesis models including endothelial tube formation and wound healing experiments. The same preparation binds an anti-VEGFA monoclonal antibody with an EC50 of 0.68–0.84 ng/mL, providing a quantitative benchmark for antibody characterization, neutralization assays, and ELISA standard curve generation. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in cell proliferation assays and in vivo tumor vascularization models where low contaminant levels are critical.
-SDS.jpg)
-AC1.jpg)
-AC2.jpg)
