Recombinant Human V-set domain-containing T-cell activation inhibitor 1 (B7H4), partial

Code: CSB-EP801822HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
B7H4
Uniprot NO.
Research Area
Immunology
Alternative Names
B7 family member, H4; B7 H4; B7 homolog 4; B7 superfamily member 1; B7 superfamily, member 1; B7-H4; B7h.5; B7h4; B7S1; B7x; BC032925; Immune costimulatory protein B7-H4; Immune costimulatory protein B7H4; MGC41287; PRO1291; Protein B7S1; RP11 229A19.4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V set domain-containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; VCTN1; Vtcn1; VTCN1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-258aa
Target Protein Sequence
IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
Gene References into Functions
  1. None of the genotype distributions showed a significant difference from the control group for the rs10801935 polymorphism. We conclude that B7-H4 has the potential to be a useful prognostic marker in urothelial carcinoma. PMID:28425229
  2. B7-H4/NF-kappaB signaling is involved in the EMT and invasion of bladder cancer cells. PMID:29391086
  3. The aim of the present work was to evaluate the effectiveness of anti-B7-H4-scFv-CH3 against tumors in vitro and in vivo. ScFv can inhibit signaling pathways to improve immunity by binding with the T lymphocyte negative co-stimulatory factor B7-H4. PMID:30207312
  4. High B7-H4 expression is associated with phyllodes tumors. PMID:30486739
  5. Studies suggest that V-set domain containing T cell activation inhibitor 1 protein (B7S1) may represent a very promising candidate to be targeted to treat various tumors. PMID:30069671
  6. Human Immunodeficiency virus type-1 myeloid derived suppressor cells inhibit cytomegalovirus inflammation through IL-27 and B7-H4. PMID:28338007
  7. High B7-H4 expression is associated with glioblastoma. PMID:30159779
  8. Serum B7-H4 detection, either alone or in combination with carbohydrate antigen 125, has an acceptable value in the diagnosis of OC. PMID:29970702
  9. the findings of this study suggested that B7-H4 may have the potential to be a valuable prognostic marker and a target for individualized therapies for gastric cancer PMID:29436630
  10. Upregulation of B7-H4 promotes tumor progression of intrahepatic cholangiocarcinoma. PMID:29235470
  11. B7-H3 protein is expressed in the majority of NSCLCs and is associated with smoking history. High levels of B7-H3 protein have a negative prognostic impact in lung carcinomas. Coexpression of B7-H3 with PD-L1 and B7-H4 is relatively low, suggesting a nonredundant biological role of these targets. PMID:28539467
  12. When compared to early-stage lung adenocarcinoma, metastatic pleural adenocarcinoma possessed higher level of nuclei membranous B7-H4 and lower cytoplasmic B7-H4 expression. PMID:28923053
  13. The decrease of B7-H4 expression in salivary glands of Sjogren's syndrome patients contributes to the defect of negatively regulating the inflammation caused by CD4(+) T cells. PMID:28217953
  14. Preclinical investigation into B7-H4-specific chimeric antigen receptor (CAR) T cells, antibody-mediated blockade of B7-H4, and anti-B7-H4 drug conjugates has shown antitumor efficacy in mouse models. PMID:28325750
  15. This meta-analysis demonstrated that high B7-H4 expression is an unfavorable prognostic factor in NSCLC. PMID:28404927
  16. This meta-analysis clarified that high B7-H4 expression in tissue was significantly associated with poor survival in patients with solid tumors. PMID:27058425
  17. in pulmonary adenocarcinoma presenting with SPN, nuclear membrane localization of B7-H4 within the tumor cells is associated with increased malignancy PMID:27438152
  18. Study reportes that B7-H3 and B7-H4 are highly expressed in human esophageal cancer tissues and significantly associated with tumor invasion. PMID:27764786
  19. Results revealed B7-H4 to be associated with poor prognosis in patients with pancreatic cancer liver metastasis. B7-H4 may promote pancreatic cancer metastasis. PMID:27750217
  20. PD-L1, IDO-1, and B7-H4 are differentially expressed in human lung carcinomas and show limited co-expression. While PD-L1 and IDO-1 are associated with increased tumor-infiltrating lymphoycte and IFN-gamma stimulation, B7-H4 is not. PMID:27440266
  21. B7-H4 activation on Mphis/microglia in the microenvironment of gliomas is an important immunosuppressive event blocking effective T-cell immune responses. PMID:27001312
  22. Knockdown of B7-H4 significantly up-regulated 57 miRNAs and down-regulated 14 miRNAs. PMID:29145206
  23. Increased serum levels of sB7-H4 in early pregnancy in premature rupture of the amniotic membranes cases may indicate the dynamics of the immune response at the feto-maternal interface and, thus, may serve as a predictive marker for this pregnancy complication. PMID:27302185
  24. our study demonstrates a strong promoting role of B7-H4 in lung tumor growth, progression and metastasis PMID:28061481
  25. results demonstrated for the first time that miR-125b-5p could regulate the inflammatory state of macrophages via directly targeting B7-H4 PMID:28754594
  26. B7-H4 is highly expressed in pancreatic cancer, and is an independent predictor of poor prognosis. PMID:28600225
  27. Evidence of associations between genotypes and Juvenile Idiopathic Arthritis were found for VTCN1, while VTCN1_rs2358820 GA was associated with Uveitis . PMID:28145159
  28. B7-H4 is highly expressed in human OSCC tissue, and the B7-H4 expression level was associated with the clinicopathological parameters containing pathological grade and lymph node status. PMID:27383830
  29. High B7-H4 expression is associated with non-Hodgkin lymphoma. PMID:28246881
  30. B7-H4 is frequently expressed in ovarian serous carcinomas, especially high-grade serous carcinomas, and may represent a novel immunotherapeutic target in this cancer. PMID:27349304
  31. While PD-L1 expression correlated with MSI and high grade endometrial tumors, B7-H4 expression was independent of grade, histology and immune cell infiltration. PMID:28347512
  32. the present review highlights the therapeutic potential of targeting B7-H4 in cancer PMID:28258701
  33. Survival rate of the patients with higher B7-H4 expression was significantly worse than that of the patients with lower B7-H4 expression. PMID:28412458
  34. Study provides evidence that B7-H4 expression is present in cervical intraepithelial neoplasia and cervical cancer patients and suggests its involvement in cervical cancer progression. PMID:28260085
  35. this review shows that targeting the B7-H4 molecule may provide a promising potential for anticancer immunotherapy PMID:27258187
  36. Higher expression of HBx and B7-H4 was correlated with tumor progression of hepatitis B virus-hepatocellular carcinoma, suggesting that B7-H4 may be involved in facilitating HBV-related hepatocarcinogenesis. PMID:27182163
  37. Aberrant expression of B7-H4 has been identified to correlate with the TNM stage, differentiation degree and lymph node metastasis in patients with HCC. PMID:27840912
  38. B7-H4 may be overexpressed on the majority of cells in the IDC microenvironment, including macrophages. In vitro experiments revealed that M1 and M2 cells expressed B7-H4. Compared with M1 cells, M2 cells exhibited significantly higher expression levels of B7-H4. PMID:27430170
  39. wortmannin and rapamycin inhibit B7-H4-mediated tumor immunoresistance through regulating B7-H4 subcellular distribution. Taken together, these results suggest that PI3K/Akt/mTOR inhibitors might be used for adjuvant therapy aimed at inhibition of immune evasion. PMID:28064317
  40. Unstable cell surface antigens are not suitable as targets for ADCC, and we therefore performed an indirect ADCC-redirecting T-cell cytotoxicity assay to study B7-H4 using polyclonal anti-mouse IgG antibody-mediated linking. PMID:27632942
  41. Knockdown of B7-H4 increased CD8+ T cell-mediated cytotoxicity in vitro. PMID:27177355
  42. study provided the first evidence that B7-H4 facilitated esophageal squamous cell carcinoma cell proliferation through promoting IL-6/STAT3 positive loopback pathway activation PMID:27088889
  43. B7H4 antigen is a negative prognostic marker for pancreatic cancer patients and also seems to express resistance of pancreatic cancer patients to chemotherapy with gemcitabine. PMID:25924930
  44. B7-H3 and B7-H4 are involved in esophageal squamous cell carcinoma (ESCC) progression and development and their coexpression could be valuable prognostic indicators. PMID:26411671
  45. study suggest that serum B7-H4 is an independent prognostic indicator for HCC and may be a promising biomarker for early diagnosis as well as disease prognosis of HCC. PMID:26505457
  46. Data show that disrupted control of costimulation, evidenced by VTCN1 loss in both APCs and pancreatic islets, ultimately results in altered balance of control of immune responses. PMID:26773144
  47. Studied VTCN1 gene polymorphisms in susceptibility to Breast Cancer. PMID:25385143
  48. Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA. PMID:26301886
  49. In human amniotic fluid stem cells, the negative co-stimulatory molecule B7H4 regulates low immunogenicity, which can provide a modest inflammatory reaction microenvironment for wound repair. PMID:26101181
  50. In women who underwent elective cesarian section, a significant increase in sB7-H4 serum levels occurred postpartal, while in women who experienced spontaneous onset of labor, there were no differences between prepartal and postpartal levels. PMID:25907449

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, i
Database Links

HGNC: 28873

UNIGENE: Hs.546434

KEGG: hsa:79679

STRING: 9606.ENSP00000358470

OMIM: 608162

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products