Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
TP1B; Non receptor tyrosine phosphatase 1; Protein phosphotyrosylphosphatase 1B; Protein tyrosine phosphatase 1B; Protein tyrosine phosphatase non receptor type 1; Protein tyrosine phosphatase placental; Protein-tyrosine phosphatase 1B; PTN1_HUMAN; PTP 1B; PTP-1B; PTPN 1; PTPN1; Tyrosine protein phosphatase non receptor type 1; Tyrosine-protein phosphatase non-receptor type 1
Species
Homo sapiens (Human)
Expression Region
1-321aa
Target Protein Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our high-quality Recombinant Human PTPN1 protein is expertly designed for researchers working in the field of signal transduction. This partial Tyrosine-protein phosphatase non-receptor type 1 (Protein-tyrosine phosphatase 1B; PTP-1B) is expressed in an E.coli system and covers the 1-321aa region of the protein. For ease of purification and detection, the PTPN1 protein features both N-terminal 10xHis and C-terminal Myc tags, ensuring consistent performance and trustworthy results throughout your research endeavors.
Our Recombinant Human PTPN1 protein boasts a purity greater than 85% as determined by SDS-PAGE, and is available in both liquid and lyophilized powder forms. Trust this exceptional protein to support your signal transduction research and deliver reliable, high-quality results.