Abbreviation
Recombinant Human TNFRSF25 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Anti-TNFRSF25 recombinant antibody(CSB-RA839000MA2HU). The EC50 is 4.485-5.277 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Human TNFSF15(CSB-MP023992HU1c9). The EC50 is 13.26-15.80 ng/mL.
Alternative Names
Tumor necrosis factor receptor superfamily member 25; Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; TNFRSF25; APO3, DDR3, DR3, TNFRSF12, WSL, WSL1; UNQ455/PRO779
Species
Homo sapiens (Human)
Expression Region
25-199aa
Target Protein Sequence
QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal Twin-Strep-Avi tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/ml can bind Anti-TNFRSF25 recombinant antibody(CSB-RA839000MA2HU). The EC50 is 4.485-5.277 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/ml can bind Human TNFSF15(CSB-MP023992HU1c9). The EC50 is 13.26-15.80 ng/mL.
Description
Death receptor 3 (DR3) mediates apoptosis and T-cell co-stimulation upon engagement by TL1A, making it a critical node in immune regulation and cancer biology. This mammalian-expressed construct spanning residues 25–199 captures the complete extracellular ligand-binding domain and demonstrates quantified receptor-ligand interaction with an EC50 of 13.26–15.80 ng/mL for human TL1A binding, providing a validated basis for competitive inhibition assays, therapeutic antibody epitope mapping, and small-molecule inhibitor screening in drug discovery programs. The protein also exhibits specific antibody recognition with an EC50 of 4.485–5.277 ng/mL in functional ELISA, supporting its use as a positive control in binding assays and for affinity characterization by surface plasmon resonance or biolayer interferometry. Mammalian expression ensures native glycosylation and disulfide bond formation critical for conformational integrity, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg align with standards expected in therapeutic antibody screening and receptor-ligand interaction studies.
