Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active)

In Stock
Code: CSB-MP023986HU(F2)
Size:
20ug
20ug100ug1mg
US$136
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TNFSF11 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 at 2 μg/mL can bind Human TNFRSF11B (CSB-MP023969HU). The EC50 is 4.514-5.152 ng/mL.
Target Names
TNFSF11
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor (ODF); Osteoprotegerin ligand (OPGL); Receptor activator of nuclear factor kappa-B ligand (RANKL); TNF-related activation-induced cytokine (TRANCE); Tumor necrosis factor ligand superfamily member 11, membrane form; Tumor necrosis factor ligand superfamily member 11, soluble form; CD254; TNFSF11; OPGL, RANKL, TRANCE
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
63-244aa
Target Protein Sequence
GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 at 2 μg/ml can bind Human TNFRSF11B (CSB-MP023969HU). The EC50 is 4.514-5.152 ng/mL.
Description

RANKL is the principal cytokine driving osteoclast differentiation and a key activator of NF-κB signaling, making it indispensable in bone biology and tumor microenvironment research. This recombinant human TNFSF11 partial protein (residues 63–244 of Isoform 2), expressed in mammalian cells with an N-terminal 6xHis tag, demonstrates strong binding to its decoy receptor osteoprotegerin (TNFRSF11B) with an EC50 of 4.514–5.152 ng/mL in functional ELISA, confirming signaling-competent conformation suitable for osteoclast differentiation assays, NF-κB pathway activation studies, and use as a coating antigen or positive control in antibody development workflows. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the stringent criteria needed to prevent LPS-driven artifacts in primary monocyte and macrophage precursor cultures. These specifications also provide a suitable basis for in vivo tumor biology models where RANKL-mediated signaling influences metastatic bone disease.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products