Recombinant Human Tubulin beta chain (TUBB)

In Stock
Code: CSB-EP025318HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TUBB
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Tubulin beta-5 chain
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-444aa
Target Protein Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.6 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Gene References into Functions
  1. human tumor cells can acquire spontaneous mutations in beta1-tubulin that cause resistance to paclitaxel PMID:20103599
  2. Roles of tubulin beta 1,3 residues Ala428 and Thr429 in microtubule formation in vivo. PMID:19074767
  3. TUBB exon 4 mutations and mismatch repair defects do not play a significant role in paclitaxel/cisplatin resistance PMID:16095531
  4. Mutations in either TUBB or MAPRE2 cause circumferential skin creases Kunze type. PMID:26637975
  5. the dipole moments of each tubulin isotype may influence their functional characteristics within the cell, resulting in differences for MT assembly kinetics and stability PMID:16941085
  6. Leucine point mutations viz. L215H, L217R, and L225M were reported for paclitaxel resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations in TUBB1 was explored using molecular docking, molecular dynamics simulation, binding energy estimation, free energy decomposition, principle component analysis and free energy landscape methods. PMID:27233604
  7. Data suggest a looser binding of the ligand in tubulin mutants. PMID:26081685
  8. Data show that tubulin phosphorylation and acetylation play important roles in the control of microtubule assembly and stability. PMID:26165356
  9. Data suggest that, while lacking a stable structure, NFL-TBS.40-63 peptide (a peptide derived from light neurofilament protein) preferentially binds on a specific single site located near C-terminal end of beta-tubulin. PMID:26016807
  10. Citrullination of TUBB is associated with neoplasms. PMID:24099319
  11. mechanism of binding and stabilization of microtubules in mammalian cells can be effectively modeled in yeast and also having the advantage of lacking any beta-tubulin isotypes that can complicate interpretation of experiments in mammalian cells. PMID:24161989
  12. Studies suggest that tubulin-interactive agents have the potential to play a significant role in the fight against cancer. PMID:23818224
  13. results provide insight into the functional repertoire of the tubulin gene family, specifically implicating TUBB5 in embryonic neurogenesis and microcephaly PMID:23246003
  14. TQ induced a concentration- and time-dependent degradation of alpha/beta tubulin in both cancer cell types. PMID:21881916
  15. Allele frequencies between a group of 191 ITP patients & controls showed no direct aetiological role for SNP (R307H), but it was associated with immunomodulatory treatment failure. PMID:23157319
  16. Data show that knockdown of S100P led to downregulation of thioredoxin 1 and beta-tubulin and upregulation of RhoGDIA, all potential therapeutic targets in cancer. PMID:21327297
  17. This is the first cell-based evidence to support a beta-tubulin-binding site for peloruside A and laulimalide. PMID:21653684
  18. Mutational analysis of the class I beta-tubulin gene in human breast cancer PMID:12209587
  19. the influence of beta-tubulin mutations in paclitaxel resistance in advanced non-small cell lung cancer PMID:12826311
  20. Review of studies comparing beta-tubulin mutations with antitubulin drug resistance. Throws doubts on earlier such correlation because of the existence of many pseudogenes for beta-tubulin. PMID:15003198
  21. These data indicate that phosphorylation of tubulin by Cdk1 could be involved in the regulation of microtubule dynamics during mitosis. PMID:16371510
  22. cDNA subtraction revealed increased expression of alpha3-tubulin in the taxol-resistant cell line. PMID:16380805
  23. Nuclear matrix proteins such as mutant Pyst1 and nucleophosmin 1 were downregulated, whereas eIF6 and beta-tubulin were upregulated during cell differentiation in hepatocarcinoma cells. PMID:17569113
  24. Results suggest that glutamate198 in beta-tubulin is a critical determinant for microtubule stability and Taxol resistance. PMID:17869412
  25. This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia. PMID:19405953

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
Tubulin family
Tissue Specificity
Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
Database Links

HGNC: 20778

UNIGENE: Hs.636480

KEGG: hsa:203068

STRING: 9606.ENSP00000339001

OMIM: 156610

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products