Abbreviation
Recombinant Human TREM2 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 2 μg/mL can bind Anti-TREM2 recombinant antibody(CSB-RA024405MA5HU). The EC50 is 1.145-1.358 ng/mL. ②TREM2 Recombinant Monoclonal Antibody (CSB-RA024405MA5HU) captured on Protein A Chip can bind Recombinant Human TREM2 with an affinity constant of 0.146 nM as detected by TREM2aSPR Assay (WeSPRTM 200).
Alternative Names
Triggering receptor expressed on myeloid cells 2; TREM-2; Triggering receptor expressed on monocytes 2
Species
Homo sapiens (Human)
Expression Region
19-174aa
Target Protein Sequence
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 2 μg/ml can bind Anti-TREM2 recombinant antibody(CSB-RA024405MA5HU). The EC50 is 1.145-1.358 ng/mL.
-
Activity
TREM2 Recombinant Monoclonal Antibody (CSB-RA024405MA5HU) captured on Protein A Chip can bind Recombinant Human TREM2 with an affinity constant of 0.146 nM as detected by TREM2aSPR Assay (WeSPRTM 200).
Description
TREM2 plays a central role in microglial function and neuroinflammatory signaling, making high-confidence interaction data essential for antibody and ligand-binding studies. This recombinant human TREM2 fragment (residues 19–174) encompasses the extracellular immunoglobulin-like domain and is produced in mammalian cells to preserve native glycosylation and conformational integrity critical for receptor-ligand recognition. Functional validation demonstrates an EC50 of 1.145–1.358 ng/mL in ELISA-based antibody binding and a sub-nanomolar SPR affinity (KD = 0.146 nM), providing a suitable basis for ligand-binding interaction assays, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the criteria typical for use as a positive control in binding assays and for small-molecule or biologic inhibitor screening in drug discovery workflows.