Abbreviation
Recombinant Human TMPRSS2 protein (R255Q), partial
Purity
≥85% as determined by SDS-PAGE.
Alternative Names
TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10
Species
Homo sapiens (Human)
Expression Region
106-492aa(R255Q)
Target Protein Sequence
WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG-
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Recombinant Human TMPRSS2 His tag protein (CSB-MP023924HU(M)b0) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 19.16μM.
-
Activity
Measured by Bromhexine Hydrochloride inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Bromhexine Hydrochloride inhibit EC50 is 81.79-154.2μM.
-
Activity
Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.005877- 0.01293μM.
Description
The recombinant human transmembrane protease serine 2 (TMPRSS2) (R255Q) is expressed in the mammalian cells with N-terminally tagged 10xHis motif. Its expression region corresponds to amino acid residues 106-493 of the human TMPRSS2 protein. The purity of this recombinant protein is over 90% determined by the SDS-PAGE. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. Validation of its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) shows this protein is active. It is available now. The target protein TMPRSS2 is a cell surface protein mainly expressed by endothelial cells across the respiratory and digestive tracts. It participates in the cleavage of peptide bonds of proteins that have serine as the nucleophilic amino acid within the active site acts. Emerging evidence has shown that TMPRSS2 acts to activate the SARS-CoV-2 spike (S) protein and facilitate viral entry into host cells.
b0-SDS.jpg)
b0-AC1.jpg)
b0-AC2.jpg)
b0-AC3.jpg)
