Recombinant Human Transgelin (TAGLN)

Code: CSB-RP008044h
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TAGLN
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
22 kDa actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha ;SM22-alpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-201aa
Target Protein Sequence
ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Actin cross-linking/gelling protein. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Gene References into Functions
  1. High expression level of TAGLN is associated with prostate cancer. PMID:26934553
  2. this study identified potential biochemical players involved in distant recurrence and indicates that R-Ras and Transgelin are potential post-surgical prognostic biomarkers for Stage III colorectal cancer PMID:27270312
  3. During transition from the pluripotent stage towards the neural developmental stage, TAGLN is differentially expressed in bipolar patient derived cells compared to control derived cells. PMID:28117838
  4. Data (including data from studies using cells cultured from transgenic/knockout mice) suggest that expression and degradation of transgelin in myofibroblasts and keratinocytes are regulated by mechanical tension in cytoskeleton produced by myosin II motor in response to stiffness of culture matrix/extracellular matrix. PMID:28898058
  5. transgelin (TAGLN), a transforming growth factor beta (TGFbeta)-inducible gene, was identified as an upregulated gene during in vitro osteoblastic and adipocytic differentiation of human bone marrow-derived stromal (skeletal) stem cells PMID:27490926
  6. Smooth muscle 22 regulates the proliferation of aortic smooth muscle cells participates in the development of thoracic aortic dissection. PMID:27320219
  7. regulates vasculogenic mimicry in breast cancer cells by enhancing interleukin-8 uptake PMID:28058861
  8. Serum concentrations of CK-18 fragments and transgelin-2 correlate with the severity of NAFLD, but not with obesity. PMID:27740519
  9. Increases or decreases in transgelin levels have reciprocal effects on tumor cell behavior, with higher expression promoting metastasis PMID:26847345
  10. activated AKT and JNK signaling pathways promote the overexpression of transgelin PMID:26694173
  11. Cofilin-1 and transgelin may play roles in the carcinogenesis and development of esophageal squamous cell carcinoma PMID:26344167
  12. Both tissue and salivary transgelin mRNA were closely correlated with various important clinicopathological parameters and were independent prognosis factors for oral squamous cell carcinoma. PMID:26242444
  13. SM22alpha is a phosphorylation-regulated suppressor of IKK-IkappaBalpha-NF-kappaB signaling cascades. PMID:25937534
  14. EZH2 regulates the chromatin structure at the TAGLN promoter through tri-methylation of H3K27, acting as an epigenetic integrator of IL-1beta and TGFbeta2 signaling. PMID:25917318
  15. Transgelin may be an excellent diagnostic marker of Triple negative tumors and could be useful in stratification of patients PMID:25841305
  16. Results indicate that miR-144 may regulate osteosarcoma cell proliferation and invasion by downregulating its target gene, transgelin protein (TAGLN), suggesting that miR-144 may be a potential therapeutic target for the treatment of osteosarcoma. PMID:25318625
  17. TAGLN was highly expressed in NF1-deficient malignant peripheral nerve sheath tumors compared to NF1-deficient plexiform neurofibromas. Upregulation was caused by increased transcriptional expression. The TAGLN gene was hypomethylated in the MPNST cells. PMID:25109740
  18. our data suggest that TAGLN may be a viable therapeutic target and a potential biomarker for predicting the prognosis of patients with lung adenocarcinoma. PMID:24938684
  19. The expression and biological role of transgelin seem to differ among various types of tumor cells and stroma, and possibly change during tumor progression. PMID:24476357
  20. They also antagonized the TGF-beta1 induced up-regulation of CTGF and transgelin. PMID:24828686
  21. Downregulated proteins in gallbladder cancer included serine protease HTRA1 and transgelin, which have been reported to be downregulated in several other cancers. PMID:24657443
  22. HIF-2alpha upregulates transgelin indirectly and accumulated TGF-beta1 is a mediator in the upregulation of transgelin by HIF-2alpha under hypoxia. PMID:24464808
  23. In leiomyosarcomas versus all other sarcomas transgelin emerged as the best diagnostic marker PMID:23174934
  24. Expression of SM22 is inhibited in human CRC, and SM22 may act as a positive regulator of the processes of autophagy. PMID:23538046
  25. Our results indicate that transgelin plays a promoting role in tumor progression, and appears to be a novel prognostic marker for advanced pancreatic cancer. PMID:23331552
  26. the expressions of TAGLN were significantly reduced in colorectal carcinoma tissues and cells, and overexpression of TAGLN could decrease the proliferation and invasion and increase the apoptosis of LoVo cells PMID:23138394
  27. COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma. PMID:22365974
  28. Depletion of SM22 could contribute to tumourigenic properties of cells. Reduction in SM22 would tend to promote cell survival when cells are under hypoxic stress, and may also contribute to increases in actin dynamics that favour metastatic potential. PMID:22257561
  29. Strong transgelin expression is observed in renal tissue of patients with glomerulonephritis; its distribution is comparable to that of alpha-smooth muscle actin (alpha-SMA), a marker of myofibroblast activation in the kidney. PMID:21677441
  30. SM22alpha overexpression enhances tumor cell growth and activates the IGF1R/PI3K/Akt pathway via direct interaction with IGF1Rbeta. PMID:22245152
  31. The expression of Transgelin in the uterine body smooth muscle tissue of pregnant women during labor was higher than in non-labor. PMID:21051832
  32. We found an increased expression of the TAGLN gene in endometriotic lesions compared with the eutopic endometrium of the same patients by real-time polymerase chain reaction. PMID:21763649
  33. Down-regulation of SM22alpha in breast cancer is correlated with lymph node metastasis. PMID:21092460
  34. Results indicate that the metastatic potential of CSCs arises from highly expressed Transgelin. PMID:20707403
  35. these findings provide the first demonstration that SM22alpha modulates cellular senescence caused by damaging agents via regulation of the p16(INK4a)/pRB pathway in HepG2 cells and that these effects of SM22alpha are partially mediated by MT-1G. PMID:20705054
  36. Expression of the actin-associated protein transgelin (SM22) is decreased in prostate cancer PMID:20012321
  37. Loss of SM22 is a molecular signature of colon cancer and is closely associated with progression, differentiation, and metastasis of colon cancer. PMID:20336793
  38. results are indicative of p53-mediated mitochondria-associated apoptotic effects of transgelin on LNCaP cells in addition to its known suppressive effects on the AR pathway PMID:20098441
  39. in pulmonary adenocarcinoma, overexpression of TAGLN was strictly localized to the tumor-induced reactive myofibroblastic stromal tissue compartment, whereas overexpression of TAGLN2 was exclusively localized to the neoplastic glandular compartment PMID:19848416
  40. loss of transgelin gene expression may be an important early event in tumor progression and a diagnostic marker for breast and colon cancer development. PMID:11773051
  41. Transgelin functions as a suppressor to inhibit prostate cancer cell growth PMID:17082327
  42. crystallization and X-ray diffraction of transgelin. PMID:17305610
  43. SM22 expression in SMCs was dramatically higher than in GC cells, which indicates that SM22 is unlikely to be a proper biomarker for GC. PMID:17629319
  44. tagln is a novel target of TGF-beta/Smad3-dependent gene expression in alveolar epithelial type II cells PMID:18245174
  45. 2.3 A resolution crystal structure of full length human transgelin, whose main structural feature is confirmed to be a CH domain. PMID:18291675
  46. acts as a tumour suppressor; expression is lost in prostate, breast and colon cancers PMID:18378184
  47. Identificaton of transgelin a novel biomarker for gastric adenocarcinoma. PMID:18446369
  48. Selective overexpression of airway smooth muscle genes in asthmatic airways leads to increased Vmax, thus contributing to the airway hyperresponsiveness observed in asthma. PMID:19011151
  49. Transgelin was expressed in pulmonary artery smooth myocytes under hypoxia compared with normoxia via and HIF-1alpha-independent pathway. Reducting transgelin expression by RNA interference impaired migration especially under hypoxia. PMID:19188659
  50. Loss of transgelin involves gene promoter hypermethylation and is closely associated with poor overall survival in colorectal cancer patients. PMID:19329940

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Calponin family
Database Links

HGNC: 11553

UNIGENE: Hs.410977

KEGG: hsa:6876

STRING: 9606.ENSP00000278968

OMIM: 600818

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products