Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

Code: CSB-EP618010HU1a0
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TEAD4 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TEAD4
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
TEA domain family member 4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
217-434aa
Target Protein Sequence
RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
Gene References into Functions
  1. TEAD4, the transcription factor that mediates Hippo-YAP signalling, undergoes alternative splicing facilitated by the tumour suppressor RBM4. PMID:27291620
  2. Combining single site-directed mutagenesis and double mutant analyses, the authors conduct a detailed analysis on the role of several residues located at the YAP:TEAD interface. The results provide quantitative understanding of the interactions taking place at the YAP:TEAD interface and give insights into the formation of the YAP:TEAD complex and more particularly on the interaction between TEAD and the ohm-loop found ... PMID:28430104
  3. Studied the effect of TEAD4 acylation on its interaction with YAP and TAZ; found YAP and TAZ bind in a similar manner to both acylated and non-acylated TEAD4. Also found TEAD4 acylation significantly enhances its stability. PMID:28960584
  4. High TEF3 expression is associated with cell cycle progression and angiogenesis in colon cancer. PMID:26885617
  5. Osmotic stress promotes TEAD4 cytoplasmic translocation via p38 MAPK in a Hippo-independent manner. Stress-induced TEAD inhibition predominates YAP-activating signals and selectively suppresses YAP-driven cancer cell growth. PMID:28752853
  6. The transcription factor TEAD4 regulates a pro-metastasis transcription program in a YAP-independent manner in CRC, thus providing a novel mechanism of TEAD4 transcriptional regulation and its oncogenic role in CRC, independently of the Hippo pathway. PMID:26387538
  7. our work provides a structural basis for understanding the regulatory mechanism of TEAD4-mediated gene transcription PMID:28368398
  8. Our results suggest that TEAD4 plays a role in the pathophysiology of atypical teratoid/rhabdoid tumor, which represents a new insight into the biology of this aggressive tumor PMID:27966820
  9. It was found that the TEAD4-YAP complex in the nuclei may be related closely to transcriptions of G1 arrest-related genes. PMID:28315328
  10. Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription. PMID:26832411
  11. TEAD4 and KLF5, in collaboration, promoted triple negative breast cancer cell proliferation and tumor growth in part by inhibiting p27 gene transcription PMID:25970772
  12. potential anti-oxidation gene and can prevent H2O2-induced endothelial cell oxidative damage by activating Klotho PMID:26041389
  13. TEAD4 overexpression induced p16 in HAoSMCs homozygous for the nonrisk coronary disease allele, but not for the risk allele. PMID:26487755
  14. the peptides TEF3-11-66 and TEF3-1197-434 functioned as two independent activation domains, suggesting that N-terminal domain of TEF3-1 also has transcriptional activation capacity PMID:25687649
  15. Edg-1 is a potential target gene of RTEF-1 and is involved in RTEF-1-induced angiogenesis in endothelial cells. PMID:24520353
  16. the multilevel perturbations of TEAD4 at epigenetic, transcriptional and posttranslational levels may contribute to GC development. PMID:24325916
  17. These data suggest that TFF3 and survivin expressions play a vital role in gastric cancer development, and these two proteins are important markers for prognosis in gastric cancer. PMID:22996285
  18. convergent optimization of the YAP/TAZ TEAD binding site suggests that the similarity in the affinities of binding of YAP to TEAD and of TAZ to TEAD is important for Hippo pathway functionality. PMID:23780915
  19. High TEAD4 expression is associated with Age-Related Macular Degeneration. PMID:22761647
  20. These results show that RTEF-1-stimulated IGFBP-1 expression may be central to the mechanism by which RTEF-1 attenuates blood glucose levels. PMID:22843786
  21. Blocking connexin 43 function inhibited RTEF-1-induced endothelial cell connections and aggregation PMID:22652601
  22. RTEF-1 plays an important role in FGFR1- stimulated vasodilatation. PMID:22433836
  23. RTEF-1 as a regulator of HIF-1alpha transcription PMID:21540178
  24. the RTEF-1-driven increase of VEGF-B plays an important role in communication between the endothelium and myocardium PMID:21169295
  25. TEF3, mainly its nuclear localization, is required for VEGF-A(165)-induced endothelial proliferation, migration, tube formation, and in vivo Matrigel angiogenesis. PMID:21169383
  26. Constitutive activation of alpha1-adrenergic signaling through the RTEF-1 transcription factor results in chronic elevation of PP1beta expression and connexin dephosphorylation. This mechanism may underlie some defects in cardiac conduction. PMID:15520314
  27. Novel RTEF-1 transcripts are present within human ocular vascular endothelial cells and mouse neural retina during normal and retinopathy of prematurity development, and alternatively spliced products are produced under hyperoxic and hypoxic conditions PMID:17652751
  28. The gain of function studies indicated that TEA domain family member 4 activate NR5A1 gene expression. PMID:18579725
  29. TEF3 mediates the expression of Down syndrome candidate region 1 isoform 1 (DSCR1-1L) in endothelial cells PMID:18840614
  30. The paper described several reasons to designate the putative translation initiation codon as the leucine (TTG) codon, which is 7 codons upstream from the isoleucine (ATT) codon. PMID:8921372
  31. The paper described that the ORF of TEF-3 initiates with an ATT codon encoding isoleucine. PMID:8702974

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
Database Links

HGNC: 11717

UNIGENE: Hs.94865

KEGG: hsa:7004

STRING: 9606.ENSP00000352926

OMIM: 601714

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products