Home
Product
Protein
Recombinant Proteins
Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

VGLL3

Uniprot NO.

A8MV65

Research Area

Transcription

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-320aa

Target Protein Sequence

MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Isoform 2

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May act as a specific coactivator for the mammalian TEFs.

Gene References into Functions

this study identified a VGLL3-regulated network as a previously unknown inflammatory pathway that promotes female-biased autoimmunity PMID:27992404
VGLL3 is involved in tumor suppressor pathways, a feature that is characterized by the absence of VGLL3 expression in high-grade serous ovarian carcinomas samples. PMID:23415753
vestigial-like 3 (Vgll3) is an inhibitor of adipogenesis PMID:23152581
data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas PMID:20842732
This protein was named Vestigial-like 3, because it is related to the Drosophila protein Vestigial. Like other members of this family, it contains a consensus TEF-1 and MEF2(TDU)interaction domain. PMID:12376544