Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VGLL3
Uniprot NO.
Research Area
Transcription
Alternative Names
VGLL3; Transcription cofactor vestigial-like protein 3; Vgl-3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-320aa
Target Protein Sequence
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May act as a specific coactivator for the mammalian TEFs.
Gene References into Functions
  1. this study identified a VGLL3-regulated network as a previously unknown inflammatory pathway that promotes female-biased autoimmunity PMID:27992404
  2. VGLL3 is involved in tumor suppressor pathways, a feature that is characterized by the absence of VGLL3 expression in high-grade serous ovarian carcinomas samples. PMID:23415753
  3. vestigial-like 3 (Vgll3) is an inhibitor of adipogenesis PMID:23152581
  4. data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas PMID:20842732
  5. This protein was named Vestigial-like 3, because it is related to the Drosophila protein Vestigial. Like other members of this family, it contains a consensus TEF-1 and MEF2(TDU)interaction domain. PMID:12376544

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Vestigial family
Tissue Specificity
Enriched in placenta.
Database Links

HGNC: 24327

UNIGENE: Hs.606507

KEGG: hsa:389136

STRING: 9606.ENSP00000381436

OMIM: 609980

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1