Home
Product
Protein
Recombinant Proteins
Recombinant Human Toll-like receptor 4 (TLR4), partial

Recombinant Human Toll-like receptor 4 (TLR4), partial

In Stock

Code: CSB-EP023603HU1

Rate （N/A）
Review （0）
Citation （2）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$256

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

TLR4

Uniprot NO.

O00206

Research Area

Cardiovascular

Alternative Names

ARMD10; CD284; CD284 antigen; ESOP 1; ESOP1; Homolog of Drosophila toll; hToll; LY 96; LY96; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2; Protein MD 2; Protein MD2; TLR 4; TLR4; TLR4_HUMAN; TOLL; Toll like receptor 4; Toll-like receptor 4

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

27-631aa

Target Protein Sequence

EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

72.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer，50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Amino acids 27-631 form the expressed segment for recombinant Human TLR4. The expected molecular weight for the TLR4 protein is calculated to be 72.4 kDa. Expression of this TLR4 protein is conducted in e.coli. The TLR4 coding gene included the N-terminal 10xHis tag, which simplifies the detection and purification processes of the recombinant TLR4 protein in following stages of expression and purification.

Toll-like receptor 4 (TLR4) is a crucial member of the Toll-like receptor family, playing a central role in the innate immune system. TLR4 is primarily expressed on the surface of immune cells, such as macrophages and dendritic cells, and recognizes specific molecular patterns associated with pathogens, particularly lipopolysaccharides (LPS) found in the outer membrane of gram-negative bacteria. Upon ligand binding, TLR4 undergoes conformational changes, leading to the activation of downstream signaling pathways, including the MyD88-dependent and TRIF-dependent pathways. This activation results in the production of pro-inflammatory cytokines, type I interferons, and the upregulation of co-stimulatory molecules, essential for coordinating immune responses against infections. TLR4 is not only involved in host defense against pathogens but is also implicated in the pathogenesis of various inflammatory diseases. Research on TLR4 focuses on understanding its signaling mechanisms, identifying novel ligands, and exploring its potential as a therapeutic target for modulating immune responses in infectious and inflammatory conditions.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Citations

Target Background

Function(From Uniprot)

Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni(2+). Responses triggered by Ni(2+) require non-conserved histidines and are, therefore, species-specific. Both M.tuberculosis HSP70 (dnaK) and HSP65 (groEL-2) act via this protein to stimulate NF-kappa-B expression. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via TLR2, but also partially via this receptor. Activated by the signaling pathway regulator NMI which acts as damage-associated molecular patterns (DAMPs) in response to cell injury or pathogen invasion, therefore promoting nuclear factor NF-kappa-B activation.

Gene References into Functions

the presence of polymorphism Asp299Gly gene TLR4 in patients co-infected with HIV/HCV indicates a high risk of metabolic disturbances PMID:30204113
high expression of (TLR4) is associated with Type 2 diabetes mellitus. PMID:30403590
Data suggest that the toll-like receptor 4 (TLR4) mutant-specific conformational alterations may help in deciphering the mechanism of loss-of-function mutations. PMID:28272553
TLR4 and TLR9 mRNA were elevated in blood samples from celiac disease patients compared to the healthy controls PMID:30057921
high TLR4 expression level during acute rejection was associated with adverse kidney allograft outcome PMID:29475090
the results of the present study showed significantly higher mRNA expression levels for TLR4 180days post-transplantation in the graft dysfunction group compared to well functioning graft group PMID:29452169
the expression levels of TLR4/MyD88 were positively correlated with the metastatic potential of breast cancer cells and tumors. The expression levels of TLR4/MyD88 may be used as a biomarker to evaluate the prognosis and guide the treatment of patients with breast cancer. PMID:30066873
These results suggest that celastrol exerts its protective effect partly via inhibiting the TLR4mediated immune and inflammatory response in steatotic HepG2 cells. PMID:30015859
No association between the SNPs rs10983755 A/G, rs4986791 C/T, rs4986790 A/G, rs10759932 C/T, rs1927911 C/T, rs11536889 C/G, and rs12377632 C/T and heart transplant rejection was found PMID:30177119
The results revealed that TLR4 and COX-2 were upregulated in PCa tissues; silencing of TLR4 or COX-2 inhibited PCa cell proliferation, migration, and invasion. PMID:30098292
The role of IDO1-IDO2-AHR pathway in the TLR4-induced tolerogenic phenotype in human dendritic cells has been reported. PMID:28256612
TLR4 Asp299Gly polymorphism potentially leading to the development of recurrent hydatidosis, by skewing the immune system towards a Th2 response PMID:29602972
Study demonstrated that HMGB1 and TLR4 could contribute to the inflammatory lichen planus process in skin. PMID:29728859
Physical interaction between p38 and eNOS was demonstrated by immunoprecipitation, suggesting a novel, NO-independent mechanism for eNOS regulation of TLR4. In correlation, biopsy samples in patients with systemic lupus erythematous showed reduced eNOS expression with associated elevations in TLR4 and p38, suggesting an in vivo link. PMID:29061842
The overexpression of miR-140 inhibited the upregulation of the expression of TLR4. PMID:29901170
TLR4 small interfering RNA blocked hUGT1A1/hNRs downregulation. PMID:29311138
The expression of TLR4 in perihematoma tissue began to increase within 6 hours after intracerebral hemorrhage and decreased after 72 hours. PMID:29990607
miR-20a could negatively regulate TLR4 and NLRP3 signaling to protect human aortic endothelial cells from inflammatory injuries. PMID:29653364
Study provides clear evidence that resistin is a clinically relevant endogenous ligand for TLR4, which promotes tumor progression via TLR4/NF-kappaB/STAT3 signaling. PMID:28991224
The antitumor effect of curcumin was related to the inhibition HSP70-TLR4 signaling. PMID:29901164
Activates the NFkappaB pathway through the Tolllike receptor 4 (TLR4)/myeloid differentiation factor 88 (MyD88)/IkappaBalpha axis. PMID:29916535
An MRP-TLR4 dependent signaling may play an important role in the pathogenesis of autoimmune thyroid diseases. PMID:29656212
The pathways involved in the effect of ROCK1 in human corneal epithelial cells was preliminarily explained by detecting changes of TLR4-mediated NF-kB and ERK signaling. PMID:29804125
Serum TLR4 was closely related to AA and associated with some AA-related circulating markers PMID:29649455
Fibrinogen induced podocyte injury via the TLR4-p38 MAPK-NF-kappaB p65 pathway in focal segmental glomerulosclerosis. PMID:28407405
Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID:29230705
Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID:29150600
Low TLR4 expression is associated with pancreatic ductal adenocarcinoma. PMID:30246618
An association exists between P. gingivalis and P. intermedia with increased TLR-4 and NF-kappaB expression in the placenta of pre-eclamptic women with periodontitis. PMID:28349674
TLR4 SNPs were not associated with acute graft rejection in kidney transplant recipients. PMID:28411360
TLR4 Thr399Ile polymorphism was associated with increased risk of Crohn's disease in Asia and Asians. [meta-analysis] PMID:29421805
Our results indicated TLR4 SNP rs11536889 may be a marker for intracranial aneurysm risk PMID:29754966
the expression of TLR4 in gingival tissues and on mast cells increased with the severity of chronic periodontitis, suggesting that TLR4, particularly mast cell TLR4, may be important in the disease process of human chronic periodontitis. PMID:29488617
Report shows that rheumatoid arthritis (RA) patients express functional TLR4 on peripheral CD8+ T cells that directly promote T-cell function and differentiation to Tc1. The study also suggests that TLR4 signals directly drive Tc1 development and T cell activation independent of TCR engagement. PMID:28424490
Resistin promoted lung adenocarcinoma metastasis through the TLR4/Src/EGFR/PI3K/NF-kappaB pathway. PMID:29927028
imcreased TLR4 expression in gastric cardia lesions may be associated with gastric cardia cancer tumorigenesis PMID:29670922
The immunoenhancement effect of PSP against lung cancer is mediated by TLR4-MAPK/NF-kappaB signaling pathways PMID:29343453
LPS stimulation induced TLR4 expression and increased pigmentation. TLR4 expression was not detected after single-dose UVA or UVB treatment, but pigmentation increased. Repeated UV treatment induced TLR4 expression and increased pigmentation. LPS stimulation and repeated UV treatment increased IL-6 secretion, and repeated UVB treatment increased IL-10 secretion. PMID:29063638
data suggest that high-phosphate conditions directly induce vascular calcification via the activation of TLR4/NF-kappaB signaling in VSMCs PMID:29227975
LncRNA MEG3 ameliorates respiratory syncytial virus infection by suppressing TLR4 signaling. PMID:29257348
Study shows that the toll-like receptor 4 gene rs1927914 polymorphism was associated with susceptibility to ischemic stroke in males. Moreover, the rs10759932 polymorphism may affect inflammatory response in ischemic stroke patients. PMID:29075930
There was no difference found in MMP-2, MMP-9 or TLR-4 levels between non-thrombocytopenic and thrombocytopenic septic donors. PLA formation was increased in thrombocytopenic patients. PMID:29734352
there was a negative correlation between YKL-40 and TLR4 expression in chronic sinusitis patients with nasal polyps. YKL-40 and TLR4 interacted with each other to activate NF-kappaB and promote disease progression. PMID:29921378
High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID:28537664
our findings confirm that in south Tunisian patients with IBD, the TLR4-Thr399Ile variant is strongly associated with susceptibility to CD and that the two polymorphisms of this receptor (TLR4-Thr399Ile and TLR4-Asp299Gly) may play a role in the clinical expression of UC. PMID:29055077
Logistic analysis showed that both rs11536889 and rs7873784 in TLR4 were associated with risk of type-2 diabetes mellitus (T2DM) complicated by tuberculosis (TB) (T2DMTB) in additive and dominant models. Carriers with homozygous and heterozygous mutants of rs11536889 and rs7873784 were associated with higher T2DMTB risk than those with wild-type homozygotes PMID:29073942
Involvement of the TLR-4 in the mediation of the biglycan action was confirmed using a specific silent agent (siRNA). Taken together, these data could be used to develop new anti-inflammatory approaches PMID:29339093
TLR4 was significantly up-regulated in synovial tissue samples from rheumatoid arthritis patients. PMID:28987944
The results revealed a lack of association for TLR4 variant with ischemic stroke and hemorrhagic stroke, although a significant association was observed with the subtypes extracranial large artery. PMID:28963650
TREM-2 promotes acquired cholesteatoma-induced bone destruction by modulating TLR4 signaling pathway and osteoclasts activation PMID:27934908

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Early endosome. Cell projection, ruffle.

Protein Families

Toll-like receptor family

Tissue Specificity

Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells.

Database Links

HGNC: 11850

UNIGENE: Hs.174312

KEGG: hsa:7099

STRING: 9606.ENSP00000363089

OMIM: 603030

Promotions