Recombinant Human Thyroglobulin (TG), partial

Code: CSB-EP023442HU
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TG protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TG
Uniprot NO.
Research Area
Others
Alternative Names
Tg
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-300aa
Target Protein Sequence
IFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.1 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen. Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream. One dimer produces 7 thyroid hormone molecules.
Gene References into Functions
  1. High thyroglobulin expression is associated with mediastinal lymph node and lung metastases in thyroid cancer. PMID:29953410
  2. Thyroglobulin determination in fine needle aspiration biopsy washout of suspicious lymph nodes can be used in the diagnosis of recurrent papillary thyroid carcinoma. PMID:28558632
  3. Positive preoperative serum TgAb is associated with worse primary tumour characteristics but rarely showed poor prognosis, probably due to more aggressive treatment of these subjects. PMID:28493284
  4. Single nucleotide polymorphisms in the TG gene were associated with the development of Hashimoto's disease and Graves' disease, the intractability of Graves' disease, and the levels of TG mRNA expression, serum TG, and serum anti-thyroglobulin antibody. PMID:28675712
  5. Data suggest iodination of TG is involved in regulation of NIS expression in thyroid follicle via TSH/TSHR signaling; NIS expression and PKA activity are up-regulated by lowly iodinated TG; NIS expression is down-regulated and PKC activity up-regulated by highly iodinated TG. (TG, thyroglobulin; NIS, sodium/iodide symporter; PK, protein kinase; TSH, thyroid-stimulating hormone; TSHR, thyroid-stimulating hormone receptor) PMID:28396984
  6. Data show that the cutoff value for thyroglobulin measurement with fine-needle aspiration (Tg-FNA) was higher in patients with thyroids than in patients without thyroids. PMID:28454525
  7. findings proved that iodinated TG in thyroid follicular lumen regulated TTF-1 and PAX8 expression through thyroid stimulating hormone/thyroid stimulating hormone receptor (TSH/TSHR) mediated cAMP-PKA and PLC-PKC signaling pathways. PMID:28322461
  8. Data (including data from studies using knockout mice) suggest that thyrotropin/thyrotropin receptor signal transduction stimulates thyroglobulin phosphorylation and contributes to enhanced de novo triiodothyronine formation in thyrocytes. PMID:28743746
  9. Multiple factors should be taken into consideration when evaluating Tg as a marker of ID in adult populations, and the Tg results may depend on the assay used. Still, Tg is a sensitive marker of ID PMID:26851767
  10. Biallelic TG mutations most commonly underlie severe congenital hypothyroidism. PMID:27525530
  11. Mutations in Thyroglobulin gene is associated with metastasis in Thyroid Cancer. PMID:27236916
  12. Mutations in the genes for thyroglobulin and thyroid peroxidase cause thyroid dyshormonogenesis and autosomal-recessive intellectual disability PMID:27305979
  13. Patients with low-and intermediate-risk differentiated thyroid carcinoma could be considered cured when their serum thyroglobulin levels were changed 6-12 months after thyroid ablation. PMID:28137736
  14. The system is characterized by a very high sensitivity and specificity allowing the ex-vivo detection of sub ng/ml concentrations of human Thyroglobulin from needle washouts of fine-needle aspiration biopsies of thyroid nodule from different patients. PMID:26896794
  15. 22 rare non-polymorphic variants including six truncating variants and 16 missense variants of unknown significance in Chinese patients with congenital hypothyroidism. PMID:26777470
  16. Data suggest that primary functions of TG include iodide storage and thyroid hormonogenesis; combinations of nonsense mutations, frameshift mutations, splice site mutations, and missense mutations in TG occur spontaneously to cause congenital hypothyroidism and thyroidal endoplasmic reticulum stress. [REVIEW] PMID:26595189
  17. High Thyroglobulin Levels are associated with recurrence in Thyroid Carcinoma. PMID:25893415
  18. +49A/G and CT60 polymorphism of CTLA4 and E33 polymorphism of TG may be genetic risk factors for autoimmune hypothyroidism susceptibility. PMID:26963610
  19. Tg SNP haplotypes are associated with hypothyroidism, hyperthyroidism and Hashimoto's disease. PMID:26099577
  20. A prominent transient early increase in thyroglobulin levels was found in thyroid cancer patients post-radioiodine ablation. PMID:25895485
  21. The mean and median of thyroglobulin were calculated in these subgroups. Tg concentrations were dependent on gender/ PMID:25536321
  22. In the diagnosis of lymphatic metastasis in papillary thyroid carcinoma, FNA-Tg levels in the preoperative state are affected by serum Tg levels when they exceeded 1.0 mug/L. PMID:25607926
  23. Results from a Vietnamese family with goiter and hypothyroidism identified 2 novel mutations in thyroglobulin gene resulting in the abolition of the authentic splice donor sites. PMID:25633667
  24. Data suggest serum TG level (low but measurable following stimulation with recombinant thyroid stimulating hormone or withdrawal of thyroid hormone) is predictive of incomplete response to surgery/radioiodine therapy in differentiated thyroid cancer. PMID:24460082
  25. High serum thyroglobulin concentration is associated with malignancy in small follicular and Hurthle cell neoplasms of the thyroid gland. PMID:25213012
  26. Thyroglobulin may be a biomarker of iodine deficiency [review] PMID:24762031
  27. Data suggest that serum thyroglobulin levels are up-regulated in patients with well-differentiated thyroid cancers as compared to patients with benign thyroid nodules. PMID:24341425
  28. We analyzed the influence of postmortem changes on Tg concentration. Tg concentration can increase above the standard value and that a difference between the Tg concentration of RHB and LHB arises as a result of postmortem changes. PMID:24565964
  29. Regions in the Hsp60 molecule show structural similarity with the thyroglobulin (TG) and thyroid peroxidase (TPO) molecules supporting the notion that autoantibodies against TG and TPO are likely to recognize Hsp60 on the plasma membrane of oncocytes. PMID:24057177
  30. Novel truncating thyroglobulin gene mutations are associated with congenital hypothyroidism. PMID:23949896
  31. Data indicate that thyroglobulin (Tg) is a good predictor of remission of disease at 18-24 months after initial treatment and could be a useful marker to stratify risk immediately after surgery. PMID:23826916
  32. Applying the optimized cutoff value of washout thyroglobulin of 1.8 ng/mL in patients with suspicious ultrasonographic features facilitates the diagnostic evaluation of neck lymph nodes. PMID:23886742
  33. the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72. PMID:24599957
  34. A novel large imperfect DNA inversion within the TG gene causes hereditary hypothyroidism. PMID:23933148
  35. A novel point mutation in a thyroglobulin stop codon at position 768 causing congenital hypothyroidism was found in a man and his two daughters. PMID:23455760
  36. Data indicate that in residents of Belarus, serum thyroglobulin (Tg) is significantly related to presence of thyroid abnormalities. PMID:23190420
  37. Iodine-induced thyroid autoimmunity is related to TgAb and the unmasking of a cryptic epitope on Tg contributes to this relationship in humans. PMID:24064687
  38. The combined TG and CK19 quantitative real-time PCR could be used to select a previously missed group of patients with nodal involvement of Papillary thyroid cancer PMID:23900865
  39. Postoperative-stimulated Tg at the time of (131)I remnant ablation is a useful biochemical marker for prediction of disease status in patients with differentiated thyroid carcinoma after total thyroidectomy. PMID:23489940
  40. Characterization of goiter and hypothyroidism phenotypes associated with inactivating mutations in the thyroglobulin gene. PMID:23164529
  41. Ablation-Tg levels of 50 mug/L or greater are a valuable initial predictor of disease persistence/recurrence in high-risk differentiated thyroid cancer patients. PMID:23242039
  42. Glycosylation of sera thyroglobulin antibody was varied in different thyroid diseases. PMID:23360821
  43. In school-aged children, Tg is a sensitive indicator of both low and excess iodine intake. PMID:23345097
  44. the thyroglobulin gene is involved in susceptibility for Graves' disease (GD) and Hashimoto's thyroiditis in the Japanese. PMID:22662162
  45. compound heterozygous mutation in the TG gene in a Chinese twin family with congenital goiter and hypothyroidism; study provides further evidence that TG mutations cause congenital goiter and hypothyroidism, demonstrates genetic heterogeneity of the mutation and increases understanding of phenotype-genotype correlations PMID:22784463
  46. Findings suggest that thyroglobulin (Tg) and thyroid-stimulating hormone receptor (TSHR) detected in orbital connective tissues in thyroid-associated ophthalmopathy (TAO) result from local fibrocyte biosynthetic activity. PMID:22517745
  47. In patients with well-differentiated thyroid cancer, a post-thyroidectomy thyroglobulin level less than 10 ng/ml is associated with a low probability of having persistent disease. PMID:21646855
  48. Data suggest that in Hashimoto's thyroiditis, both antigens, TG and thyroperoxidase, are recognized by peripheral and thyroid gland infiltrating CD8-positive T-cells and are involved in thyroid destruction leading to clinical disease manifestation. PMID:22259066
  49. Epistasis between the HSD17B4 and thyroglobulin polymorphisms is associated with premature ovarian failure. PMID:22265031
  50. Papillary thyroid cancers Papillary thyroid cancers with no 131I uptake had slightly reduced NIS, significantly reduced thyroglobulin,thyroperoxidase and pendrin and significantly increased GLUT-1 gene expression levels. PMID:17854396

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Type-B carboxylesterase/lipase family
Tissue Specificity
Specifically expressed in the thyroid gland.
Database Links

HGNC: 11764

UNIGENE: Hs.654591

KEGG: hsa:7038

STRING: 9606.ENSP00000220616

OMIM: 188450

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products