Recombinant Human Tenascin (TNC), partial

In Stock
Code: CSB-RP115094h(C)
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TNC
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
150 225; Cytotactin; Glioma associated extracellular matrix antigen; Glioma-associated-extracellular matrix antigen; GMEM; GP 150 225; GP 150-225; GP; Hexabrachion; HXB; JI; MGC167029; Miotendinous antigen; Myotendinous antigen; Neuronectin; TENA_HUMAN; Tenascin; Tenascin-C; Tenascin-C isoform 14/AD1/16; TenascinC; TN; TN C; TN-C; TNC
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1888-2201aa
Target Protein Sequence
DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP115094h(C) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TNC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP115094h(C) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TNC.
Description

The preparation of this recombinant Human TNC protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a TNC fragment (1888-2201aa) that could be translated into the TNC protein and then transferred it into E.coli cells to express the recombinant TNC protein molecule. In order to get the target protein with high purity, N-terminal 6xHis tag was used in the production. The purity is 90% determined by SDS-PAGE.

Tenascin is an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. TNC level is undetectable in most adult tissues but rapidly and transiently induced by a handful of pro-inflammatory cytokines in a variety of pathological conditions including infection, inflammation, fibrosis, and wound healing. The increased deposition of TNC has been reported in the tumor stroma of most epithelial malignancies arising, for example, in the breast, uterus (both the cervix and body), ovary, prostate, pancreas, colon, stomach, mouth, larynx, lung, urinary tract, and skin. Interactions between epithelial (cancer) and stroma cells induce the expression of TNC by both cells, thereby facilitating the remodeling of cancer tissues. Deposited TNC in the cancer stroma modulates the cell behaviors of both cell types by interactions between cells and ECM that are mediated through integrins.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.
Gene References into Functions
  1. In addition, we found that Tn-expressing colorectal cancers (CRC) cell lines had either loss-of-function mutations in Cosmc or reversible Tn antigen expression, which was not caused by the deficiency of T-synthase activity PMID:30115016
  2. The results demonstrated that ANX2 and stromal tenascin C regulated invasion in addition to stemness and anoikis resistance, which are crucial for metastasis in the progression of pancreatic ductal adenocarcinoma. PMID:29749431
  3. Intratumor stromal expression of tenascin-C (TN-C) is a strong prognostic indicator in locally advanced unresectable (UR-LA) pancreatic ductal adenocarcinoma (PDAC) patients with resection after chemoradiotherapy (CRT). PMID:29517632
  4. this study shows that tenascin C is increased in vitiligo in lesional areas only in the acral sites PMID:29605863
  5. Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID:29150600
  6. Results identify tenascin-C as an endogenous danger signal that is upregulated in systemic sclerosis and drives TLR4-dependent fibroblast activation, and by its persistence impedes fibrosis resolution. PMID:27256716
  7. Both fetal Tn-C variants may represent novel biomarkers that are capable of estimating both pulmonary vascular remodeling and right ventricular load. PMID:29117120
  8. high TNC expression correlates with worse prognosis for lung adenocarcinoma and has a role in lung cancer progressoin PMID:28652369
  9. Decellularized lung scaffolds treated with FBN-2 and TN-C prior to re-epithelialization supported greater epithelial proliferation and tissue remodeling. PMID:28662401
  10. Immunohistochemical analysis shows that the unique association between the CD44+/CD24low/- phenotype and the pronounced production of tenascin C may have a prognostic potential, prospectively indicating the inefficiency of neoadjuvant polychemotherapy (PCT), in particular that with platinum derivatives, which is used for the standard treatment of triple-negative BC. PMID:29027523
  11. Enhanced serum tenascin-C concentrations are closely related to trauma severity and clinical outcomes PMID:28732652
  12. Functional studies showed THBS1 and TNC to mediate chemoresistance through the integrin beta1/mTOR pathway. PMID:27487140
  13. Elevated Tenascin-C serum values are associated with non-small cell lung cancer. PMID:26967391
  14. Tenascin-C was abundantly secreted by the colon cancer cells with high metastatic potential, and highly expressed in lymph nodes with metastasis. PMID:27191989
  15. Intermittent hypoxia confers pro-metastatic gene expression selectively through NF-kappaB in inflammatory breast cancer cells, in particular, to tenascin-C and MPP9. PMID:27717868
  16. Metastatic prostate cancer cells cultured on osteo-mimetic surfaces coated with tenascin C exhibited enhanced adhesion and colony formation as mediated by integrin alpha9beta1. PMID:28916657
  17. Study showed that the proinflammatory, extracellular matrix glycoprotein tenascin-C from tissue damage and microbial lipopolysaccharide (LPS) from bacterial infection activated a common set of signaling pathways, including NF-kappaB and MAPK, but these stimuli also induced different signaling pathways downstream of TLR4. PMID:27577261
  18. High Tenacin C expression is associated with liver metastasis in colorectal cancer stroma. PMID:29065427
  19. Tenascin-C protein expression in this muscle was confined to arterioles and venules (80% of cases) and increased after training in A-allele carriers. Prior to training, volume densities of subsarcolemmal and myofibrillar mitochondria in m. vastus lateralis muscle were 49% and 18%, respectively, higher in A/A homozygotes relative to T-nucleotide carriers (A/T and T/T) PMID:28384286
  20. Study that recombinant TNC consisting of the epidermal growth factor (EGF-like repeats induced cerebral arterial constriction via EGF receptor and activation of ERK1/2 PMID:27086972
  21. Tenascin-C was abundant in cortical white and gray matter in brain tissue from Alzheimer's Disease patients. PMID:27444354
  22. secreted by transdifferentiated retinal pigment epithelial cells and promotes the development of choroidal neovascularization via integrin alphaV in a paracrine manner PMID:27668890
  23. Overexpression of TNC, SMA, and vimentin were significantly correlated with the lower overall survival in prostate cancer patients. PMID:28341124
  24. analysis of SNPs in tenascin-C (TNC) associated with degenerative rotator cuff tears PMID:27248364
  25. High TNC expression is associated with retinoblastoma. PMID:27488116
  26. prepartum and postpartum TN-C serum levels significantly higher in mild and severe preeclampsia than in healthy pregnancy PMID:25567561
  27. Tenascin-C overexpression in cancer cells and stromal fibroblasts was an independent poor prognostic factor for overall survival and disease-free survival esophageal squamous cell carcinoma patients. PMID:26731558
  28. Serum TNC levels are significantly raised and correlate with various clinical and laboratory variables of disease activity in children with enthesitis-related arthritis PMID:25774061
  29. This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway. PMID:25646025
  30. Co-expression of Matrix metalloproteinase-9 and Tenascin-C was associated with poorer prognosis and was found to be an independent predictor of survival PMID:26652622
  31. Studied the expression of TNC in tissue microarrays including 17 GBMs, 18 WHO grade III astrocytomas, 15 WHO grade II astrocytomas, 4 WHO grade I astrocytomas, and 7 normal brain tissue samples by immunohistochemical staining. PMID:25469866
  32. No difference in tenascin-C expression was found in COPD. PMID:25794567
  33. miR-133a enhances the protective capacity of cardiac progenitors cells after myocardial infarction PMID:25448067
  34. A pivotal role for TNC in tuning the local immune response to establish equilibrium between disseminated nodal cancer stem cells and the immune system. PMID:25808872
  35. lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival PMID:25609695
  36. Circulating concentrations of Tn-C are higher in patients with a recent history of atherosclerotic stroke and may play an anti-inflammatory role by reducing pro-inflammatory cytokine release from atheroma. PMID:24823872
  37. Data indicate the expression of fetal ED-A(+) fibronectin and B (+) tenascin-C splicing variants in cardiac tissue from heart transplant recipients. PMID:24792713
  38. Tn-C and Gl-3 are promising markers for the diagnosis of pulmonary sarcoidosis, but they are not specific for cardiac involvement. PMID:24777587
  39. Subraracnoid hemorrhage, aneurysmal that is more severe induces more TNC, which may cause the subsequent development of both vasospasm and vasospasm-unrelated secondary brain injury, leading to ischemia. PMID:25366610
  40. The coated combination of TnC and TnR appeared to regulate neural differentiation signaling through integrin alpha7 and alpha9beta1 in bone marrow-derived human mesenchymal stem cells. PMID:24829055
  41. the fibronectin type III-like repeats in tenascin-C may be playing an important role in PCO. PMID:25515583
  42. Results found that Tenascin-C FNIIIA1 is over-expressed in osteosarcoma tissues and can promote MG-63 cell migration suggesting that high expression of A1 may promote metastasis of osteosarcoma. PMID:24598996
  43. Demonstrate that tenascin-C level is associated with pathologic conditions in acute coronary syndrome, especially the presence of ruptured plaque. PMID:23532307
  44. Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression. PMID:24503185
  45. In conclusion, although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in breast cancer patients. PMID:24696262
  46. although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in epithelial ovarian cancer patients. PMID:24722824
  47. Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1. PMID:24808173
  48. Studied serum levels of Tn-C containing the FNIIIB (B+ Tn-C) or FNIIIC (C+ Tn-C) domain in heart failure patients. Analysis of Tn-C concentrations according to heart failure etiology revealed no significant differences. PMID:25016707
  49. serum levels elevated in scleroderma PMID:23834524
  50. Serum levels of MMP-9, TIMP-1 and B(+) Tn-C and tissue levels of B(+) Tn-C and ED-A(+) Fn are promising markers for risk assessment in dilated cardiomyopathy. PMID:23998545

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Tenascin family
Database Links

HGNC: 5318

UNIGENE: Hs.143250

KEGG: hsa:3371

STRING: 9606.ENSP00000265131

OMIM: 187380

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products