DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.8
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Gene References into Functions
The ionic CD3-epsilon -Lck interaction controls the phosphorylation level of the T-cell receptor.PMID:28659468
A novel pathogenic frameshift variant of CD3E gene has been found in two unrelated T-B+ NK+ severe combined immunodeficiency infants from Turkey.PMID:28597365
the stalk domains of NKp30 and NKp46, another NCR employing CD3zeta for signaling, were not exchangeable without drastic deficiencies in folding, plasma membrane targeting, and/or ligand-induced receptor signaling.PMID:27754869
The inducible recruitment of WASp to the TCR-CD3 complex is partially dependent of tyrosine phosphorylation of Cd3e.PMID:26342115
increase. Our results indicate that the change in CD3zeta-chain expression from the baseline is an independent predictor of residual and recurrent head and neck squamous cell carcinoma.PMID:26888626
Data suggest that HIV-1 gp41 transmembrane domain (TMD) directly interacts with TMDs of the T-cell receptor and it's CD3-antigen co-receptors (delta, gamma, and epsilon); these interactions appear to be involved in immune evasion mechanism of HIV-1.PMID:26828096
that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response.PMID:24470497
ABCB1 homozygous 3435 TT carrier subjects showed the lowest Pgp activity compared with 3435 CT and CC carriers of renal transplant patients.PMID:23216707
Local changes in the lipid composition of TCR microclusters render the CD3epsilon cytoplasmic domain accessible during early stages of T cell activation.PMID:23166358
Results show that levels of CD3epsilon, CD25, CD68, and ICAM-1 mRNA in BCC biopsies may predict risk for new basal cell carcinomas.PMID:21980389
analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic micePMID:21203507
Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon.PMID:19616027
Recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation.PMID:12110186
T cell receptor can be recruited to a subset of plasma membrane rafts, independently of cell signaling and attendantly to raft clusteringPMID:12499387
CD3 expression was strong in normal proximal and distal tubular epithelium and in renal oncocytomas, weak in chromophobe carcinoma, and negative in clear cell carcinomas, in papillary renal cell carcinoma, and in a transitional cell carcinoma.PMID:16308105
The CD3 epsilon immune recognition receptor cytoplasmic domain binds to acidic and mixed phospholipid vesicles with a binding strength that correlates with the protein net charge and the presence of clustered basic amino acid residues.PMID:17176095
CD3epsilon-mediated signal transduction pathway is essential for this transformation processPMID:17507663
Notch-dependent cytoplasmic CD3 expression can only be achieved during the early phase of NK-cell differentiation.PMID:17630354
In lung adenocarcinoma patients, significant decreases of MFI values for CD3epsilon, but not CD3zeta, were found in CD4+T and CD8+T cells from pleural effusion compared to peripheral blood and in peripheral blood of patients compared to healthy donors.PMID:17668204
Data show that Nck forms a complex with an atypical PxxDY motif of the CD3epsilon tail, which encompasses Tyr166 within the activation motif and a T-cell receptor endocytosis signal.PMID:18555270
Data show that anti-CD3 monoclonal antibody (MAb)-mediated chimpanzee T-cell activation is a function of the anti-CD3 MAb isotype and is not governed by Siglec expression.PMID:18667496
Results revealed that the human CD3 epsilon subunit forms a homodimer structure, which provide insight into our understanding of the molecular assembly of the CD3 molecular complex.PMID:19724882
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.