Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

In Stock
Code: CSB-EP021679HU1
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SLC5A2
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-102aa
Target Protein Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.5kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

For the information provided for CSB-YP021679HU1 (all expression systems) is the expression region, tag information, expected tag information, and sequence the same as the CSB-CF021679HU1 ? All of the four expression systems along with the cell free were together.

A:
Thanks for your interest in our product,Yes, the information including the expression region (Expression Region: 1-102aa; Partial.) and sequence provided for CSB-YP021679HU1 (all expression systems) is the the same as the CSB-CF021679HU1.
But the tag has some differences:
As we have already successfully expressed CSB-EP021679HU1 and CSB-CF021679HU1 before, so the tags are confirmed.
The confirmed tag: EP:N-terminal 10xHis-tagged and C-terminal Myc-tagged; CF: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged;
But the tag for other expression systems will be determined during the manufacturing process.
The expected tag for other expression system: YP: N-terminal 6xHis-tagged; BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Target Background

Function(From Uniprot)
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Gene References into Functions
  1. SGLT2-I therapy is a potential new strategy for the treatment of HCC. PMID:29205334
  2. Sodium-glucose cotransporter-2 (SGLT2) is selectively expressed in the human kidney, where it executes reabsorption of filtered glucose with a high capacity; it may be overactive in patients with diabetes, especially in the early, hyperfiltering stage of the disease. As a therapeutic target, SGLT2 has been successfully engaged by orally active, selective agents. [review] PMID:28506519
  3. In this study, more than 90% of patients were on Forxiga or Invokana. Merck and Pfizer are also collaborating to bring an SGLT2 rival drug, ertugliflozin, to market as well as on two combinations containing the drug to treat type 2 diabetes. PMID:28398306
  4. Canagliflozin, an orally active inhibitor of sodium glucose co-transporter 2, is approved for the treatment of type-2 diabetes mellitus. Food did not affect canagliflozin pharmacokinetics. PMID:27136908
  5. C-peptide-based measurements of insulin secretion are appropriate for assessing beta-cell function in SGLT2 inhibitor canagliflozin-treated participants. PMID:27127999
  6. The novel pathogenic SLC5A2 mutation p.S293C was responsible for the onset of FRG PMID:28365451
  7. Molecular Interaction of Anti-Diabetic Drugs With Acetylcholinesterase and Sodium Glucose Co-Transporter 2. PMID:28387957
  8. the key pharmacodynamic effects of SGLT2 inhibitors and the clinical evidence that support the rationale for the use of SGLT2 inhibitors in patients with HF who have T2D. Because these favorable effects presumably occur independent of blood glucose lowering, we also explore the potential use of SGLT2 inhibition in patients without T2D with HF or at risk of HF, such as in patients with coronary artery disease PMID:29061576
  9. Results provide evidence that common genetic variants in the SLC5A2 gene do not affect diabetes-related metabolic traits in subjects at increased risk of type 2 diabetes. PMID:28134748
  10. SGLT2/MAP17 functions as a low-affinity Na(+)-glucose cotransporter in the kidney. PMID:28592437
  11. reported nominal effects of individual SLC5A2 variants on fasting and post-challenge glucose levels may probably not be mediated by altered glucagon release PMID:28472182
  12. Findings suggest that there are subtypes of T2DM characterized by different urinary glucose excretion and cardiovascular risk factors. SLC5A2 and HNF1A mutations partially explain renal glycosuria in patients with T2DM. PMID:28324025
  13. SGLT2 inhibitors combined with insulin might be an efficient and safe treatment modality for T1DM patients. PMID:28399981
  14. Data suggest that, by shunting substantial amounts of carbohydrate into urine, SGLT2-mediated glycosuria results in a progressive shift in energy metabolism toward fatty substrates; studies were conducted in subjects with/without diabetes type 2 treated with SGLT2 antagonist and hypoglycemic agent empagliflozin. PMID:26861783
  15. Studies indicate that Sodium-glucose cotransporter 2 (SGLT2)T2 inhibitors are promising antidiabetic agents that are gaining attention in both clinical medicine and basic research. PMID:27754601
  16. Data suggest that ketoacidosis (ketonuria/ketonemia) associated with the use of sodium-glucose cotransporter 2 protein (SGLT-2) inhibitors needs further research. PMID:27085074
  17. In both men and women, grip strength increased in both hands after sodium-glucose cotransporter 2 protein (SGLT2) inhibitor treatment . PMID:27038414
  18. Data suggest that SGLT2 plays central role in energy metabolism and renal elimination of circulating glucose; targeted inhibition of SGLT2 alters energy metabolism in diabetes and obesity. PMID:26403227
  19. Mutations in the SLC5A2 gene did not find any evidence that chronic loss of glucose in the urine would protect from deterioration of the glucose tolerance over time. PMID:26735923
  20. Data suggest that SGLT2 is transporter found in proximal renal tubules, responsible for reabsorption of most of glucose filtered by kidney; inhibition of SGLT2 lowers blood glucose level by promoting urinary excretion of excess glucose. [REVIEW] PMID:26362302
  21. Data show that thiosugars bind to sodium-glucose co-transporters vSGLT and hSGLT2 stronger and dissociate more slowly than sugars. PMID:26260238
  22. SGLT2 is functionally expressed in pancreatic and prostate adenocarcinomas PMID:26170283
  23. Results identified six SLC5A2 variants including four novel variants in Chinese familial renal glucosuria. Variant SLC5A2 proteins had altered expression levels and patterns in addition to significantly lower glucose transport in cultured cells. PMID:25339128
  24. SGLT2 inhibitor canagliflozin can be coadministered with oral contraceptives, warfarin, or digoxin without dose adjustments. PMID:25345427
  25. SGLT2 is inhibited with dapagliflozin in pancreatic alpha cells, which triggers glucagon secretion PMID:25894829
  26. Sodium glucose cotransporter 2 inhibitor empagliflozin is not associated with prolonged QT interval. PMID:23617452
  27. A single dose of canagliflozin, a sodium glucose co-transporter 2 inhibitor, 300 mg reduced both fasting and postprandial PG. PMID:25110280
  28. A possible role of common genetic variation in SLC5A2 in the control of glucose homeostasis. PMID:23651029
  29. Studies indcate that glucose is present in the glomerular filtrate and is reabsorbed by a group of transport proteins in the renal tubular epithelium, with sodium glucose transporter (SGLT)-2 quantitatively the most important. PMID:23714218
  30. Data suggest that SGLT2 plays role in tubular apoptosis in diabetic nephropathy; SGLT2-mediated, high glucose-induced generation of reactive oxygen species appears to augment apoptosis of renal tubular cells. PMID:23508966
  31. It was concluded that human SGLT1 and SGLT2 are regulated by different mechanisms and suggest that insulin is an SGLT2 agonist in vivo. PMID:22673616
  32. A total of 21 different SLC5A2 mutations were detected in a cohort of 23 unrelated Korean children with Familial renal glucosuria PMID:22314875
  33. In this review, we summarize the available data concerning the mechanism of action, efficacy, and safety of this novel antidiabetic class of therapeutic agents. PMID:22528597
  34. analysis of SGLT2 inhibitors containing the 1,2,3-triazole motif and evaluation of their urinary glucose excretion PMID:22079028
  35. TS-071 inhibited SGLT2 activity in a concentration-dependent manner. PMID:21410690
  36. Our data suggest a role of SGLT2 genetic variation in the regulation of glucose homeostasis and promote pharmacogenomic studies to clarify the efficacy of antidiabetic treatment by SGLT2 inhibitors PMID:21830867
  37. Five novel SGLT2 mutations were identified in familial renal glucosuria patients. Mutant SGLT2 proteins had significantly lower glucose transport capacity upon reconstruction in cultured cells. PMID:21165652
  38. SGLT2 plays an important role in renal tubular glucose reabsorption. PMID:14569097
  39. homozygous missense mutation in exon 8 of SLC5A2, resulting in a lysine to arginine substitution at position 321 underlies autosomal-recessive renal glucosuria and aminoaciduria PMID:15610225
  40. Thioglycoside I (phenyl-1'-thio-beta-D-glucopyranoside) inhibited hSGLT2. PMID:17505558
  41. Within 17 pedigrees, we have identified a total of 20 different SLC5A2 mutations in familial renal glucosuria. PMID:18622023

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Database Links

HGNC: 11037

UNIGENE: Hs.709195

KEGG: hsa:6524

STRING: 9606.ENSP00000327943

OMIM: 182381

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products