Abbreviation
Recombinant Human SLC34A2 protein, partial (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL.
Alternative Names
Sodium-phosphate transport protein 2B;Na+;NaPi3b;Sodium/phosphate cotransporter 2B;Na+;NaPi-2b;Solute carrier family 34 member 2
Species
Homo sapiens (Human)
Expression Region
234-362aa
Target Protein Sequence
VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal mFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/ml can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL.
Description
Sodium-dependent phosphate transport protein 2B regulates inorganic phosphate homeostasis in epithelial tissues, and its dysregulation has been implicated in pulmonary alveolar microlithiasis and certain cancers. This recombinant fragment spanning residues 234–362 demonstrates robust antibody-binding activity in functional ELISA, with an EC50 of 32.86–37.66 ng/mL when immobilized at 2 μg/mL, confirming that the expressed extracellular domain retains native conformational epitopes. The validated binding capacity supports its use in antibody development workflows, including epitope mapping and as an ELISA standard for anti-SLC34A2 reagent characterization. Produced in mammalian cells with dual His and mFc tags, the protein achieves greater than 90% purity by SDS-PAGE and maintains endotoxin levels below 1.0 EU/μg, satisfying the quality thresholds commonly required for ligand-binding assays and structural studies of transporter extracellular domains.