Very nice to receive your inquiry.
Recombinant Human Sodium channel protein type 1 subunit alpha(SCN1A) ,partial
CSB-MP020834HU >> Mammalian cell
Expression region:1-128aa; Fragment at the N-terminal.
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
Regarding the activity, sorry, we haven't tested the activity for the time being and we haven't received any feedback about the activity from other customers, so we can't 100% guarantee its activity.In theory, we use affinity chromatography for purification, which should be active when purified under a very mild condition.
At the same time, we are not sure if the above expression region will be of your interest. If you need another region, please feedback to us.
As for whether this protein is suitable to provide in lyophilized format, proteins are sensitive to heat, and lyophilization can maximize retain the activity of the protein during storage, extending storage time. The effects of lyophilization on proteins include: Protein partial inactivation, aggregation, and other denaturation issues. However, these negative effects can be reduced as much as possible
by adding protective agents (stabilizers, additives, excipients) and various conditions controlled during the lyophilization. In general, most proteins are still suitable for lyophilization.
At present, there is no data indicating that this protein is not suitable for lyophilization.
Therefore, please remark your requirement for lyophilization if the customer needs the lyophilized protein, and the delivery time will be extended for 3 working days.