Recombinant Human Short transient receptor potential channel 6 (TRPC6), partial

Code: CSB-MP1339HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$660
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TRPC6
Uniprot NO.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
543-592aa
Target Protein Sequence
ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.7 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion.
Gene References into Functions
  1. TRPC6 was upregulated in Diabetic nephropathy and could promote cell proliferation and inflammation by inhibiting the NFAT signaling pathway in tubular epithelial cells. PMID:29288897
  2. Changes in podocyte TRPC channels evoked by plasma and sera from patients with recurrent FSGS and by putative glomerular permeability factors. PMID:28629718
  3. Confirmed serine 14 as a target of MAPKs and proline-directed kinases like cyclin-dependent kinase 5 (Cdk5) in cell-based as well as in vitro kinase assays and quantitative phosphoproteomic analysis of TRPC6. Phosphorylation of TRPC6 at serine 14 enhances channel conductance by boosting membrane expression of TRPC6, whereas protein stability and multimerization of TRPC6 are not altered. PMID:28877958
  4. Reduction of TRPC6 activity, using either TRPC6 siRNA or a TRPC6 blocker, led to inhibition of hypoxia-induced autophagy, while enhancement of TRPC6 activity with a TRPC6 activator resulted in increased hypoxia-induced autophagy. PMID:30078002
  5. axonal colocalization of TRPV4 and TRPC6 was found in the digital Meissner corpuscles PMID:27874267
  6. Data suggest that TRPC6-mediated elevation of intracellular Ca2+ stimulates non-small cell lung cancer proliferation by promoting cell cycle progression. PMID:28030826
  7. potential implications of transient receptor potential (TRP) channels in the pathogenesis of intestinal fibrosis, since they are known to act as cellular stress sensors/transducers affecting intracellular Ca(2+) homeostasis/dynamics, and are involved in a broad spectrum of cell pathophysiology including inflammation and tissue remodeling. PMID:27818466
  8. Studies provide evidence that the TRPC6-mediated signaling pathway in kidney cells is under control of reactive oxygen species under both physiological and pathological conditions. [review] PMID:26937558
  9. Functional interaction of upregulated CaSR and upregulated TRPC6 in pulmonary artery smooth muscle cells from idiopathic pulmonary arterial hypertension patients may play an important role in the development and progression of sustained pulmonary vasoconstriction and pulmonary vascular remodeling. PMID:26968768
  10. Our comprehensive analysis of human disease-causing TRPC6 mutations reveals loss of TRPC6 function as an additional concept of hereditary focal segmental glomerulosclerosis and provides molecular insights into the mechanism responsible for the loss-of-function phenotype of TRPC6 G757D in humans PMID:26892346
  11. study demonstrated that the various mechanisms regulating MDR in HCC cells are calcium dependent through the TRPC6/calcium/STAT3 pathway. We propose that targeting TRPC6 in HCC may be a novel antineoplastic strategy, especially combined with chemotherapy PMID:27011063
  12. n response to stretching (20%), ATP was released only from the foremost cells at the wound edge; it then diffused to the cells behind the wound edge and activated the P2Y receptors, which caused propagating Ca(2+) waves via TRPC6 PMID:28210627
  13. Data suggest that targeted manipulation of protein kinase C isoforms PKCalpha, PKCbeta, and PKCeta might be beneficial in certain proteinuric kidney diseases with altered transient receptor potential cation channel subfamily C member 6 protein (TRPC6) functions. PMID:26404773
  14. Insulin increases the expression of TRPC6 channels in podocytes by activation of the calcineurin-dependent pathway. PMID:26849622
  15. This study described the expression and functional relevance of TRPC6 in the pathophysiology of HK-2 cell following ischemia reperfusion. PMID:26913924
  16. Genetic Interactions Between TRPC6 and NPHS1 Variants Affect Posttransplant Risk of Recurrent Focal Segmental Glomerulosclerosis. PMID:26147534
  17. These findings suggest that lysoPC induces CaM phosphorylation at Tyr(99) by a Src family kinase and that phosphorylated CaM activates PI3K to produce PIP3, which promotes TRPC6 translocation to the cell membrane. PMID:26858457
  18. This study demonstrated that TRPC6 reduction or haploinsufficiency leads to altered neuronal development, morphology and function. PMID:25385366
  19. TRPC6 specifically interacts with APP leading to inhibition of its cleavage by gamma-secretase and reduction in Abeta production. PMID:26581893
  20. results suggest that TRPC6 regulates metabolism to affect HIF-1alpha stability and consequent glucose metabolism in human glioma cells under hypoxia PMID:26187851
  21. the transient receptor potential canonical-6 (TRPC6) calcium-permeable channel in the alveolar macrophages also functions to shunt the transmembrane potential generated by proton pumping. PMID:26604306
  22. TRPC6 genetic variants are promising candidate predictors of nervous system involvement in systemic lupus erythematosus PMID:26531690
  23. Selectively activating endothelial TRPC6 rescues transendothelial migration PMID:26392222
  24. TRPC6 plays a prominent role in thrombin-evoked delta-granule platelet exocytosis and calcium mobilization. PMID:26386308
  25. This study seems to suggest that c.1-361A > T, c.1-254C > G and c.1-218C > T polymorphisms in TRPC6 gene and c.1166A > C polymorphism in AGTR1 could have a role in the development of this disease. PMID:25603901
  26. distribution and activity of TRPC6 can be regulated by cardiotonic steroids like ouabain and the naturally occurring peptide Abeta(1-40) which underlines the pathophysiological significance of these processes. PMID:26348127
  27. mutation at N157T can lead to alteration in glycation whereas mutation at A404V was present at a ligand binding site PMID:26127002
  28. these findings provide strong evidence for a role of immunophilins, including FKBP25 and FKBP38, in NCCE mediated by TRPC6. PMID:26239116
  29. TRPC6 polymorphisms do not affect susceptibility to, or clinical outcomes of idiopathic membranous nephropathy. PMID:25019165
  30. Exogenous H2O2 does not induce oxidative stress due to rapid degradation to produce O2 in the podocytes, but the oxygenated podocytes become sensitive to acute ethanol challenge and undergo apoptosis via a TRPC6-dependent elevation of intracellular Ca2+. PMID:25601712
  31. Renal ischemia-reperfusion injury induced podocyte effacement and the upregulation of TRPC6 mRNA and protein expression. In in vitro experiments, oxygen glucose deprivation (OGD) treatment enhanced the expression of TRPC6 and TRPC6-dependent Ca2+ influx. PMID:25896763
  32. a new pathway for TRPC6 activation by Phospholipase C epsilon PMID:25521631
  33. TRPC6 activation and inactivation are regulated by PI(4,5)P2 hydrolysis. PMID:24470487
  34. Studied the expression of TRPC6 among prostate cancer cells; experimental results showed that the overexpression of TRPC6 could promote the invasion ability of PC3 prostate cancer cells. PMID:24418082
  35. High glucose modifies TRPC6 channels and ROS production via SDC-4 in human podocytes. PMID:24942878
  36. the TRPC6 activation mainly occurs at lipid rafts, which is regulated by the mechanical cues of surrounding materials. PMID:24397990
  37. -254C>G, a SNP underlying enhanced TRPC6 transcription and expression, may be correlated with the development of steroid resistance in Chinese children with idiopathic nephrotic syndrome. PMID:23999069
  38. TRPC6 mechanical activation and activation evoked by DAG/ATP occur through distinct biophysical mechanisms, and provide support for the hypothesis that protein complexes containing wild-type TRPC6 subunits can be intrinsically mechanosensitive. PMID:24598806
  39. High expression of TRPC6 mRNA was associated with the higher pT status. PMID:23686700
  40. Expression of TRPC6 is markedly increased in renal cell carcinoma specimens and plays an important role in tumor cell proliferation. PMID:23700295
  41. The triple mutation Arg852/Lys859/Arg860 exhibited significant disruption of the binding of S100A1 to TRPC6 implicating their involvement in the binding site. PMID:23671622
  42. TRPC6 gain-of-function mutation is associated with late-onset focal segmental glomerulosclerosis. PMID:23291369
  43. Increasing expression levels of the transient receptor potential cation channel 6 gene in the blood accompanies chronic elevation of intraocular pressure in primary open-angle glaucoma and may serve as a genetic biomarker PMID:23566105
  44. Mutations of TRPC6 and ACTN4 occur in only a minor portion of Chinese familial familial focal segmental glomerulosclerosis patients. PMID:23689571
  45. A novel frame shift mutation in TRPC6, D873fsX878 was found in a family with podocytopathy. PMID:23663351
  46. ANP attenuates the inflammatory actions of histamine via endothelial GC-A/cGMP/cGKI signaling and inhibitory phosphorylation of TRPC6 channels. PMID:23814119
  47. Data indicate that expression of mutant TRPC6 induces ERK1/2 activation via both cell-autonomous and non-cell-autonomous mechanisms. PMID:23645677
  48. data show that TRPC6 is likely to be a target for 11q21-22.2 amplification that confers enhanced invasive behavior to head and neck squamous cell carcinomas cells. PMID:23497198
  49. this paper defines a specific role of TRPC6 channels in CXCR2-induced intermediary chemotaxis. In particular, TRPC6-mediated supply of calcium appears to be critical for activation of downstream signaling components. PMID:23636057
  50. an important role of NF-kappaB in a negative regulation of TRPC6 expression at the gene transcription level in kidney cells. PMID:23525112

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC6 sub-subfamily
Tissue Specificity
Expressed primarily in placenta, lung, spleen, ovary and small intestine. Expressed in podocytes and is a component of the glomerular slit diaphragm.
Database Links

HGNC: 12338

UNIGENE: Hs.159003

KEGG: hsa:7225

STRING: 9606.ENSP00000340913

OMIM: 603652

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products