Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Abbreviation
CD163
Purity
>85% (SDS-PAGE)
Target Names
CD163
Uniprot NO.
Alternative Names
C163A_HUMAN; CD 163; CD163; CD163 antigen; CD163 molecule; Hemoglobin scavenger receptor; M130; M130 antigen precursor; Macrophage associated antigen; MM130; OTTHUMP00000238617; OTTHUMP00000238618; OTTHUMP00000238619; OTTHUMP00000238620; SCARI1; Scavenger receptor cysteine rich type 1 protein M130; sCD163; Soluble CD163
Species
Homo sapiens (Human)
Source
Yeast
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

We're looking for the soluble CD163 for human and mouse.
According to the mouse sequence the extracellular domain is aa39-1045 which is probably too long to make?
http://www.uniprot.org/uniprot/Q2VLH6
I see that CSB-EP650452MO corresponds to sequence 86-365aa but do you have anything longer?
Please can you suggest the proteins for both human and mouse that are the closest you can come to this request?
Thank you

A:
Thanks for your inquiry. Soluble CD163 recombinant protein for Human
Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130(CD163) ,partial
CSB-EP801238HU >> E.coli
Expression Region: 51-366aa; Partial, provide the SRCR 1,SRCR 2,SRCR 3 Domain
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

LRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNEDAGVTCS


If you need longer sequence, you can tell us the specific sequence or expression region, we can try custom service for you, and the length of sequence within 800aa is risk-free service.
Below is the custom service of extracellular domain (42-1045aa) of Human soluble CD163 recombinant protein. Since its length is over 800aa, we will charge according to different steps.
Product Name:Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130(CD163) ,partial
Expression region: 42-1050aa;Partial, provide the complete extracellular domain.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.

Sequence:SSLGGTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSALKTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRLVGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKTLGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMGDCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLRLVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGPIWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLEVFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPDTLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCTDISVQKTPQKATTGRSSRQSS


Reference:http://www.uniprot.org/uniprot/Q86VB7
The Cat No for each expression system is listed as follows:
CSB-YP801238HU1 >> Yeast
CSB-EP801238HU1 >> E.coli
CSB-BP801238HU1 >> Baculovirus
CSB-MP801238HU1 >> Mammalian cell
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you need to pay for the gene synthesis and subcloning and we will provide the constructed plasmid and strains.
PS: The expression plasmid is not for sale if this project is successful.

Target Background

Function(From Uniprot)
Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.; After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.
Gene References into Functions
  1. high plasma levels of sCD163 is associated with measles virus infection. PMID:29795672
  2. Increased sCD163 levels in sputum are associated with the impairment of lung function in asthma patients PMID:30246699
  3. Expression of CD163 in urinary bladder cancer cells is significantly correlated with macrophage infiltration and might have a tumor promoting impact. PMID:29288002
  4. A separate measurement of the two forms of CD163 constituting 'soluble CD163' in plasma may therefore add to the diagnostic and prognostic value. PMID:28084321
  5. our results suggest that MR and CD163 may be novel biomarkers for CRC detection and survival evaluation. PMID:29226859
  6. Data suggest a novel pathophysiological role of CD163 in type 2 diabetes; monocyte surface CD163 levels are significantly associated with insulin resistance in patients with type 2 diabetes; the association of insulin resistance with soluble CD163 levels is less significant. This study was conducted in Japan. PMID:29445750
  7. Detection of the CD163 antigen on cancer cells might be a useful marker for evaluating the clinical course of patients with clear cell renal cell carcinoma PMID:28687956
  8. CD163-expression by cancer cells was significantly associated with MI and clinicopathological data. Patients with CD163-positive tumors had significantly shorter disease-free survival (DFS) after RT. PMID:29725763
  9. Plasma CD163 levels were increased in obese and type 2 diabetes mellitus patients compared to controls. PMID:28406702
  10. soluble CD163 is associated with markers of liver necro-inflammation and glucose homoeostasis in non-alcoholic fatty liver disease. PMID:28715286
  11. The effect of LPS in the expression of CD163 and CD206 on monocytes is not reverted in LPS tolerant cells, and the inhibition of inflammatory cytokines in tolerant cells is not related with modulation of these receptors PMID:26352275
  12. The cumulative incidence of de novo-onset cGVHD was higher in patients with higher plasma soluble CD163 concentrations at day 80 than those with lower concentrations (75% versus 40%, P = .018). The cumulative incidence of de novo- or quiescent-onset cGVHD did not differ statistically according to concentrations of the 3 other proteins at day 80. PMID:28455006
  13. Although sCD163 level cannot predict the development of varices, it serves as a good predictor for the detection of size of varices (large varices), the need of prophylactic interventions, and risk of variceal bleeding. sCD163 level is a helpful indicator with the progression of cirrhosis and portal hypertension. PMID:28282272
  14. CD163 and ferritin are biomarkers of functional outcomes in intracerebral hemorrhage. PMID:28392117
  15. the simultaneous detection of both plasma sCD14 and IL-6 is a promising diagnostic approach to identify active pulmonary tuberculosis, and further, measurement of TNF-alpha and sCD163 can identify the most severe cases of tuberculosis. PMID:27591510
  16. The macrophage activation marker CD163 was increased in patients with active pulmonary TB compared with age- and sex-matched control subjects. PMID:27684274
  17. alveolar macrophages from asthmatic subjects have reduced cell-surface expression of CD163, which suggests that CD163 might modulate the pathogenesis of asthma PMID:26376364
  18. Serum sCD163 might be a potential biomarker for predicting the severity and prognosis of PM/DM-related interstitial lung disease PMID:28103926
  19. Soluble CD163 reflecting macrophage activation is associated with morphological features of non-alcoholic fatty liver disease. An independent association between sCD163 and cytokeratin-18 suggests that apoptosis may contribute to macrophage activation in NAFLD/NASH. PMID:27102725
  20. Most cases of histiocytic sarcoma expressed histiocytic markers CD68 (6 of 7 cases), CD163 (5 of 5 cases), and PU.1 (3 of 4 cases). PMID:28805986
  21. Within a diabetic cohort, the percentage of monocytes expressing CD163 was decreased in those subjects with complications, compared to those without complications. These changes were not accompanied by a change in gene expression. Glucocorticoids increased CD163 expression in cultured peripheral blood monocytes from non-diabetic persons. PMID:27354410
  22. sCD163 was markedly elevated in autoimmune hepatitis (AIH) in the acute phase, normalised by successful treatment in complete responders, but remained higher in the incompletely responding cases. Our results demonstrate macrophage activation in AIH paralleling disease activity, severity and treatment response, suggesting a role for macrophage activation in AIH. PMID:27679428
  23. High CD163 expression is associated with glomerular inflammation in lupus nephritis. PMID:27242373
  24. analysis of plasma CXCL10, sCD163 and sCD14 in virological suppression and risk of cardiovascular disease PMID:27355513
  25. we found that higher percentages of circulating CD14+CD204+, CD14+CD163+CD204+ M2-like monocytes were significantly associated with TNM stage, lymph node metastasis, and histological differentiation. PMID:28639912
  26. CD163 expression is significantly upregulated in human masticatory mucosa during wound healing PMID:28005267
  27. Soluble CD163, which is identified as a marker of inflammation and type II diabetes, is elevated in polycystic ovary syndrome. PMID:26985764
  28. soluble CD163 modulates the immune response to Dermatophagoides pteronyssinus allergens potentiating anti-inflammatory, homeostatic mechanisms. PMID:27100336
  29. The mean serum-soluble CD163 level was higher in the ANCA-associated renal vasculitis patients with infectious complications than in the active-vasculitis patients, inactive-vasculitis patients, and normal controls. PMID:27094919
  30. we have developed a highly sensitive targeted probe capable of detecting CD163-expressing macrophages that could provide useful information about the state of the atheromatous lesions. PMID:26616677
  31. A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin. PMID:26568320
  32. Increased soluble CD163 blood levels in hepatocellular carcinoma patients correlates with rapid hepatocellular carcinoma progression. PMID:26549495
  33. these data indicate that sCD163 is a prognostic marker in B-CLL. PMID:25747973
  34. sCD163 is a sensitive marker protein for liver failure. PMID:26339412
  35. CD163-positive macrophages predict outcome in follicular lymphoma, but their prognostic impact is highly dependent on treatment received. PMID:25869385
  36. therapy with rituximab, cyclophosphamide and fludarabine resulted in a significant reduction in the number of non-classical CD14+CD16++ monocytes and soluble form of CD163 but upregulation of membrane-associated monocyte CD163 PMID:26135617
  37. Renal graft CD163+ infiltrates correlated strongly with interstitial inflammation, tubulitis, and peritubular capillaritis. PMID:26087825
  38. Higher levels of circulating monocyte-platelet aggregates are correlated with viremia and increased sCD163 levels in HIV-1 infection. PMID:25109683
  39. CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation. PMID:26045748
  40. The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection. PMID:26569178
  41. Soluble CD163 is increased in patients with acute pancreatitis. PMID:26209500
  42. CD163 may be correlated with disease severity and the disease progression in patients with hemorrhagic fever with renal syndrome; however, the underlying mechanisms should be explored further. PMID:25392926
  43. Suggest MelanA-negative spindle-cell associated melanoma constitutes a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin. PMID:25602697
  44. The scavenger receptor CD163 has been found to be over-expressed in Head and neck squamous cell carcinoma. PMID:24858806
  45. Show a high percentage of CD163+ tumor-associated macrophages and a low percentage of S100+ dendritic cells in thymic carcinoma samples. PMID:25499804
  46. CD163 is a biomarker for the clinical assessment of macrophage proliferation and activity that would help in risk prediction of bone and lung involvement and monitoring treatment response PMID:25587690
  47. This study describe elevated soluble CD163 (sCD163)levels in gestational diabetes mellitus (GDM) and identify human placenta as a novel source of sCD163 suggesting that placental tissues might contribute to the increased levels of circulating sCD163 in GDM pregnancies. PMID:24983948
  48. could be potentially used as an immune diagnostic marker for malignant pleural effusion PMID:25944005
  49. Soluble CD163 may be a marker of "unhealthy" fat distribution in obese subjects. PMID:25376508
  50. IL-8 might be involved in poor clinical outcomes via generation of CD163-positive M2 macrophages, and these factors in addition to N status might have prognostic value in patients with resectable oral squamous cell carcinoma PMID:25461761

Show More

Hide All

Subcellular Location
[Soluble CD163]: Secreted.; Cell membrane; Single-pass type I membrane protein. Note=Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.
Tissue Specificity
Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed a
Database Links

HGNC: 1631

UNIGENE: Hs.504641

KEGG: hsa:9332

STRING: 9606.ENSP00000352071

OMIM: 605545

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1