Abbreviation
Recombinant Human SLAMF7 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human SLAMF7 at 2 μg/mL can bind anti-SLAMF7 recombinant antibody(CSB-RA021369MA1HU).The EC50 is 8.949-10.33 ng/mL.
②SLAMF7 Recombinant Monoclonal Antibody(CSB-RA021369MA1HU) captured on Protein A Chip can bind Human SLAMF7 with an affinity constant of 0.18 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
SLAM family member 7; CD2 subset 1; CD2-like receptor-activating cytotoxic cells; CRACC; Membrane protein FOAP-12; Novel Ly9; Protein 19A; CD antigen CD319
Species
Homo sapiens (Human)
Expression Region
23-226aa
Target Protein Sequence
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human SLAMF7 at 2 μg/ml can bind anti-SLAMF7 recombinant antibody(CSB-RA021369MA1HU).The EC50 is 8.949-10.33 ng/mL.
-
Activity
SLAMF7 Recombinant Monoclonal Antibody(CSB-RA021369MA1HU) captured on Protein A Chip can bind Human SLAMF7 with an affinity constant of 0.18 nM as detected by MetaSPR Assay (WeSPRTM 200).
-
The purity of SLAMF7 was greater than 95% as determined by SEC-HPLC
Description
SLAMF7 (CD319) is a self-ligand receptor expressed on natural killer cells, activated T cells, and multiple myeloma cells, making it a validated target for cancer immunotherapy and a key marker in hematologic malignancies. This mammalian-expressed extracellular domain (aa 23–226) exhibits a binding affinity of 0.18 nM to an anti-SLAMF7 monoclonal antibody as measured by surface plasmon resonance, demonstrating the conformational integrity required for therapeutic antibody epitope mapping, competitive inhibition screening, and receptor-ligand interaction studies. The protein supports use in functional ELISA with an EC50 of 8.9–10.3 ng/mL when immobilized at 2 μg/mL, providing quantitative benchmarks for blocking antibody validation and small-molecule inhibitor screening in oncology drug discovery. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for SPR affinity characterization and biolayer interferometry assays in immune checkpoint research.
