Recombinant Human Rhodopsin (RHO), partial

In Stock
Code: CSB-EP019681HU
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-SUMO-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RHO
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
CSNBAD1; MGC138309; MGC138311; OPN 2; OPN2; opsd; OPSD_HUMAN; opsin 2; Opsin 2 rod pigment; Opsin-2; Opsin2; Retinitis Pigmentosa 4; Retinitis pigmentosa 4 autosomal dominant; RHO; Rhodopsin; RP 4; RP4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-36aa
Target Protein Sequence
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

This recombinant human rhodopsin (RHO) protein comes from E. coli expression and covers amino acids 1-36 of the full protein. The fragment carries an N-terminal 6xHis-SUMO tag, which makes purification and detection much more straightforward. SDS-PAGE analysis shows the protein achieves greater than 90% purity—a level that should deliver reliable results for most research work.

Rhodopsin acts as a light-sensitive receptor that plays a central role in visual phototransduction. The protein handles the critical job of converting light into electrical signals within the retina. Because rhodopsin sits at the heart of vision, studying it may help researchers better understand how we see and what goes wrong in various visual disorders. This makes it a particularly valuable target for sensory biology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human rhodopsin is a complex GPCR that requires precise seven-transmembrane domain folding within a lipid membrane environment, along with the chromophore 11-cis-retinal for functional activity. This recombinant rhodopsin represents only the N-terminal extracellular domain (amino acids 1-36), which is a small, unstructured region in isolation. While E. coli can express this short peptide, it cannot provide the membrane environment or post-translational modifications necessary for the full protein's native conformation. This fragment will not adopt any biologically relevant structure related to rhodopsin's phototransduction function and is essentially a linear peptide with no functional activity.

1. Antibody Development and Validation

This recombinant rhodopsin fragment serves as an excellent immunogen for generating antibodies specific to the N-terminal region of human rhodopsin. The short, linear nature of the peptide makes it ideal for producing antibodies that recognize linear epitopes. The His-SUMO tag facilitates purification and immunization procedures. These antibodies will be particularly useful for Western blot applications under denaturing conditions.

2. ELISA-Based Binding Assays

This protein is well-suited as a standard in ELISA assays designed to detect antibodies against rhodopsin's N-terminal region. However, it is completely unsuitable for functional binding studies (e.g., with transducin or other signaling partners) as it lacks the structural requirements for specific molecular recognition.

3. Biochemical Characterization and Stability Studies

This application is valuable for understanding the physical properties of this specific peptide fragment. Techniques like circular dichroism can confirm its unstructured nature, while stability assays can determine its behavior under various conditions. However, these studies will characterize a peptide fragment, not the functional rhodopsin protein.

Final Recommendation & Action Plan

This recombinant rhodopsin is essentially a short peptide fragment of rhodopsin's N-terminus and should be treated as such, not as a functional protein domain. The immediate priority is Application 3 (Biochemical Characterization) to confirm the peptide's unstructured nature and stability profile. Application 1 (Antibody Development) can proceed confidently for generating sequence-specific antibodies. Application 2 is only suitable for immunoassay development, not functional binding studies. Protein-protein interactions require a precise tertiary structure that this short linear peptide cannot provide. Results would be uninterpretable. For any functional rhodopsin studies, a full-length protein expressed in eukaryotic membrane systems is essential.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of the chromophore 11-cis-retinal to all-trans-retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Gene References into Functions
  1. using cryo-electron microscopy, it is shown that the major interactions between activated rhodopsin and Gi are mediated by the C-terminal helix of the Gi alpha-subunit, which is wedged into the cytoplasmic cavity of the transmembrane helix bundle and directly contacts the amino terminus of helix 8 of rhodopsin PMID:29899450
  2. The identification of the pathogenic variant p.E113 K is the first description of a naturally-occurring mutation in the Schiff base counterion of RHO in patients. The heterozygous mutation c.337G > A in exon 1 was confirmed in the retinitis pigmentosa index patient as well as in five stationary night blindness-affected relatives. PMID:27812022
  3. data provide the first evidence that T17M rhodopsin mutant disrupts C3 secretion via the induction of ROS and the suppression of TWIST1. PMID:28569420
  4. Wild-type opsin mainly formed oligomers. Only a minor population formed aggregates. The G188R opsin mutant mainly formed aggregates. When wild-type opsin and G188R opsin were coexpressed in cells, properly folded wild-type opsin did not aggregate with G188R opsin and was trafficked normally to the cell membrane. The autosomal dominant phenotype due to misfolded opsin mutants is not due to WT-mutant physical interaction. PMID:27117643
  5. Data suggest that retinitis pigmentosa-associated mutation G51A behaves differently in human rhodopsin compared to bovine rhodopsin; human rhodopsin is more thermally stable than ancestral ancestrally reconstructed mammalian rhodopsin. PMID:28369862
  6. These findings provide a new understanding of the effects of oxLDL on endothelial proliferation, which is essential for developing new treatments against neovascularization and progression of atherosclerosis. PMID:28701359
  7. Study reports an X-ray free electron laser crystal structure of the rhodopsin-arrestin complex, in which the phosphorylated C terminus of rhodopsin forms an extended intermolecular beta sheet with the N-terminal beta strands of arrestin. Phosphorylation was detected at rhodopsin C-terminal tail residues T336 and S338. PMID:28753425
  8. results suggest that nonsense-mediated mRNA decay modulates the severity of retinitis pigmentosa in patients with nonsense mutations in the rhodopsin gene PMID:26416182
  9. both the charged G90D(2.57) and the hydrophobic T94I(2.61) mutation alter the dark state by weakening the interaction between the Schiff base (SB) and its counterion E113(3.28) We propose that this interference with the tight regulation of the dim light photoreceptor rhodopsin increases background noise in the visual system and causes the loss of night vision characteristic for CSNB patients. PMID:27458239
  10. A mutation-independent strategy appears viable in this specific context but certain mutations could significantly influence ribozyme or RNAi efficacy through impact on accessibility at the target annealing site/region. PMID:28715844
  11. a recurrent missense mutation (c.403C > T, p.R135W) in the rhodopsin (RHO) gene cosegregated with all retinitis pigmentosa affected individuals in the family. PMID:26794436
  12. Autosomal recessive retinitis pigmentosa with homozygous rhodopsin mutation E150K and non-coding cis-regulatory variants in CRX-binding regions of SAMD7. PMID:26887858
  13. Functional role of positively selected amino acid substitutions in mammalian rhodopsin evolution has been uncovered for a large number of mammalian species. PMID:26865329
  14. Our study shows that RHO mutations are a major cause of adRP in this cohort and are responsible for 28% of adRP families. PMID:26962691
  15. analysis of the crystal structure of the rhodopsin-arrestin complex PMID:26467309
  16. A whole-exome sequencing approach led to identification of a deletion in RHO through detection of a new linked variant in COL6A6 in autosomal dominant retinitis pigmentosa. PMID:26321861
  17. These insights into the dynamics of the ground states and the early photocycle stages enhance our understanding of the channel function of Channel rhodopsin. PMID:26114863
  18. Studies indicate that misfolding of rhodopsin can result in disruptions in cellular protein homeostasis, or proteostasis. PMID:26427449
  19. FIP3 (RAB11-FIP3) promotes the activity of Rab11a and the ASAP1 in the Arf4-dependent ciliary transport of the sensory receptor rhodopsin. PMID:25673879
  20. RHO polymorphisms (rs7984, rs2855557 and rs2410) and haplotypes may confer remarkable susceptibility to age-related macular degeneration PMID:26045836
  21. The study identified a RHO gene mutation (p.Thr58Met) not previously reported in RP in a patient with sector retinitis pigmentosa (RP). PMID:25265376
  22. Similar vacuolization in photoreceptor outer segment discs of transgenic mice expressing human rhodopsin with a T17M mutation or non-glycosylated form of rhodopsin was found. Non-glycosylated rhodopsin is unstable and is regulated via ubiquitin pathway PMID:25637522
  23. reveal the spectrum and frequency of RHO mutations in Chinese patients with different forms of retinitis pigmentosa and demonstrate that RHO mutations account for a high proportion of autosomal dominant retinitis pigmentosa cases PMID:25221422
  24. show that although the basic activation pathways of human and bovine rhodopsin are similar, structural deviations exist in the inactive conformation and during receptor activation, even between closely related rhodopsins PMID:26105054
  25. Rer1p regulates the ER retention of immature or misfolded rhodopsin and modulates its intracellular trafficking through the early secretory pathway. PMID:25096327
  26. crystal structure of a constitutively active form of human rhodopsin bound to a pre-activated form of the mouse visual arrestin, determined by serial femtosecond X-ray laser crystallography PMID:26200343
  27. RHO has an intrinsic water pathway, which in the receptors' resting state is interrupted by a hydrophobic layer of amino acid residues and upon agonist binding, opened to a continuous intrinsic water channel. PMID:25203160
  28. ERdj5 is a member of the proteostasis network that regulates rod opsin biogenesis and supports a role for disulfide bond formation/reduction in rod opsin biogenesis and disease. PMID:25055872
  29. This retrospective study provides a wide spectrum of mutations in the RHO gene in Spanish patients with autosomal dominant Retinitis Pigmentosa . PMID:25408095
  30. Data indicate that transfected human channelrhodopsin-2 (rhodopsin) increased the action potential in the rat spinal cord and activated the calcium channel in dorsal root ganglion neurons. PMID:25171072
  31. In this report we describe a New Zealand family, of European heritage, affected by a sectoral type RP phenotype in association with a novel rhodopsin mutation (proline-170-histidine) in a highly conserved site. PMID:24918165
  32. Data indicate that the number of nanodomains present in a single disc was dependent on the number of rhodopsin molecules incorporated into the membrane. PMID:25305340
  33. Electron paramagnetic resonance spectra of the spin-labeled samples indicate that the extracellular residues of RHO retain more rigidity in the denatured states than the cytoplasmic residues. PMID:25268658
  34. tHE results OF THIS STUDY identify a novel pathogenic mechanism in which the glycosylation-deficient rhodopsins are destabilized by light activation. PMID:25274813
  35. There is a correlation between the stability of rhodopsin mutations and disease severity and levels of membrane-bound rhodopsin. PMID:24520188
  36. Many biochemical studies have demonstrated that P23H mutation induces rhodopsin (RHO) misfolding leading to endoplasmic reticulum stress. PMID:24664733
  37. These studies indicate that activation of either IRE1, ATF6, or PERK prevents mutant rhodopsin from accumulating in the cells. PMID:24664756
  38. It regulates relaxation of vascular smooth muscle. PMID:24717605
  39. In the dark, rhodopsin 11-cis retinal chromophore serves as an inverse agonist to lock the receptor in an inactive state. (Review) PMID:24183693
  40. development of rod photoreceptors in TgP23H swine embryos. PMID:24618321
  41. Retinitis pigmentosa mutants provide insight into the role of the N-terminal cap in rhodopsin folding, structure, and function. PMID:24106275
  42. This study demonistrated that rhodopsin P23H mutation cause early degeneration of retin. PMID:23557623
  43. The purpose of this study was to test for mechanisms by which the autosomal dominant rhodopsin mutation Ter349Glu causes an early, rapid retinal degeneration. PMID:23940033
  44. X-ray crstallographic analysis of rhodopsin reveals the congenital stationary night blindness-causing G90D mutation introduces a salt bridge with K296. PMID:23579341
  45. The S186W mutant thermally destabilizes rhodopsin by disrupting a hydrogen bond network at the receptor's active site. PMID:23625926
  46. The c.233A>T mutation at RHO exon 1 caused sectorial retinitis pigmentosa in a pedigree with intrafamilial clinical heterogeneity. PMID:23402891
  47. Two mutations in the RHO gene have been found in two Chinese families with retinitis pigmentosa. PMID:23288993
  48. Pathogenic mutations in rhodopsin can lead to autosomal dominant retinitis pigmentosa. PMID:22791210
  49. Data suggest that BiP (HSPA5) is important for maintaining the solubility of rod opsin in the endoplasmic reticulum. PMID:22855534
  50. Less severe phenotypes occurred in patients with p.R135W in rhodopsin. PMID:23049240

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Rod shaped photoreceptor cells which mediate vision in dim light.
Database Links

HGNC: 10012

UNIGENE: Hs.247565

KEGG: hsa:6010

STRING: 9606.ENSP00000296271

OMIM: 180380

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products