Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial

In Stock
Code: CSB-EP818781HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GPRC5A
Uniprot NO.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
269-357aa
Target Protein Sequence
TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.0 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Amino acids 269-357 form the expressed segment for recombinant Human GPRC5A. The theoretical molecular weight of the GPRC5A protein is 37.0 kDa. This GPRC5A protein is produced using e.coli expression system. The GPRC5A gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant GPRC5A protein during the following stages.

Retinoic acid-induced protein 3 (RAI3), also known as GPRC5A, belongs to the G protein-coupled receptor (GPCR) family. GPRC5A is expressed in several tissues, including the lung, and has been implicated in processes such as cell proliferation, differentiation, and apoptosis. GPRC5A's role in cancer biology, particularly in lung cancer, is of significant interest, as it may function as a tumor suppressor or promoter depending on the context.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling. May act as a lung tumor suppressor.
Gene References into Functions
  1. GPRC5a was upregulated in pancreatic cancer (PaCa) leading to an enhanced drug resistance in PaCa cells. PMID:29949874
  2. under-expressed GPRC5A during lung tumorigenesis enhances any transcriptional stimulation through an active translational status. PMID:27273304
  3. findings reveal an unprecedented role for GPRC5A in regulation of the ITGB1-mediated cell adhesion and it's downstream signaling, thus indicating a potential novel role for GPRC5A in human epithelial cancers. PMID:27715394
  4. miR-204 inhibits cell proliferation in gastric cancer by targeting CKS1B, CXCL1 and GPRC5A. PMID:29283424
  5. p53 overexpression and GPRC5A induction markedly inhibited tumor cell viability and induced apoptosis. PMID:28849235
  6. GPRC5A is a potential oncogene in pancreatic ductal adenocarcinoma cells that is upregulated by gemcitabine with help from HuR. PMID:27415424
  7. These results suggest RAI3 plays an important role in adipogenesis of hASCs and may have a potential use in the future application. PMID:28870805
  8. Study underscores genomic alterations that represent early events in the development of Kras mutant LUAD following Gprc5a loss and tobacco carcinogen exposure. PMID:28653505
  9. Suppression of GPRC5a results in decreased cell growth, proliferation and migration in pancreatic cancer cell lines via a STAT3 modulated pathway, independent from ERK activation PMID:28114355
  10. our results implicate GPRC5A as a tumor suppressor in breast cancer cells, and GPRC5A exerts its tumor-suppressive function by inhibiting EGFR and its downstream pathway PMID:27599526
  11. elevated levels of GPRC5A played significant roles in gastric cancer progression PMID:26227221
  12. Results show how GPRC5A deficiency leads to dysregulated EGFR and STAT3 signaling and lung tumorigenesis. PMID:25744720
  13. EGFR interacted with GPRC5A and phosphorylated it in two conserved double-tyrosine motifs, Y317/Y320 and Y347/ Y350, at the C-terminal tail of GPRC5A. PMID:25311788
  14. The interaction of miR-103a-3p with each of the two 5' UTR targets reduces the expression levels of both GPRC5A mRNA and GPRC5A protein in one normal epithelial and two pancreatic cancer cell lines. PMID:24984703
  15. RAI3 may contribute to the malignant progression of hepatocellular carcinoma PMID:23632812
  16. Data indicate that in mammary tumors, the mRNA expression of GPRC5A significantly correlated with that of BRCA1. PMID:24470238
  17. Decreased GPRC5A expression is associated with non-small cell lung cancers and lung inflammation. PMID:23154545
  18. Loss of GPRC5A is associated with lung adenocarcinomas. PMID:20563252
  19. RAI3 is a cell growth-promoting gene and a novel P53 transcriptional target PMID:15659406
  20. This evidence explains one of the mechanisms of the GPRC5A-regulated cell growth in some cancer cell lines. PMID:17055459
  21. Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property. PMID:18000218
  22. Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported. PMID:19279407
  23. analysis of RAI3 expression in normal and cancerous human breast tissue at both the mRNA and protein levels PMID:19552806

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 3 family
Tissue Specificity
Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to mod
Database Links

HGNC: 9836

UNIGENE: Hs.631733

KEGG: hsa:9052

STRING: 9606.ENSP00000014914

OMIM: 604138

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products