Recombinant Human Retinoblastoma-associated protein (RB1), partial

Code: CSB-EP019386HU
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human RB1 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
RB1
Uniprot NO.
Research Area
Cancer
Alternative Names
p105-Rb;p110-RB1;pRb;Rb;pp110
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
729-928aa
Target Protein Sequence
KDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Human Retinoblastoma-associated protein (RB1) is produced in an E. coli expression system, covering amino acids 729 to 928 of the protein. This partial protein includes a C-terminal 6xHis tag, which helps with purification and detection in research applications. Purity exceeds 85% as verified by SDS-PAGE, which appears to ensure reliable performance in experimental setups. This product is intended for research use only.

Retinoblastoma-associated protein (RB1) functions as a crucial regulator of the cell cycle. It primarily controls the transition from the G1 phase to the S phase. The protein acts as a tumor suppressor by inhibiting cell proliferation, thus playing a significant role in maintaining genomic stability. This makes RB1 particularly valuable in cancer research and studies related to cell cycle regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human RB1 fragment (729-928aa) is expressed in E. coli, a prokaryotic system generally unsuitable for producing functional eukaryotic tumor suppressor proteins. While this partial fragment represents a specific C-terminal region of RB1, it requires precise folding to maintain any potential domain integrity and interaction interfaces. E. coli lacks eukaryotic chaperones and post-translational modification machinery, making proper folding and phosphorylation status uncertain. The C-terminal 6xHis tag may further interfere with the native structure. Although the protein shows >85% purity, the expression system and unverified activity status mean the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its structure and function.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The His-tag enables technical feasibility for pull-down experiments. However, if the RB1 fragment is misfolded, it will not maintain physiological interaction interfaces. The 729-928aa region may contain binding sites that require a specific conformation. Identified interactions could be non-physiological without proper folding validation. This application carries a high risk without prior confirmation of the native structure.

2. Antibody Development and Validation

This application remains appropriate as the safest use case. The recombinant fragment can generate antibodies recognizing linear epitopes within the 729-928aa region, even if misfolded. The His-tag facilitates purification and screening. However, antibodies may not recognize conformational epitopes of properly folded, full-length RB1 in cells. Validation against endogenous RB1 is essential.

3. Biochemical Characterization and Stability Studies

This application is well-suited for initial characterization. Biophysical techniques (circular dichroism, size-exclusion chromatography) can directly assess folding state and stability. These studies are valuable even if the protein is inactive, providing crucial data on the recombinant product's properties before functional applications.

4. Competitive Binding Assays

This application is highly problematic without folding validation. If the fragment is misfolded, binding interfaces for small molecules or peptides will not resemble native RB1. Screening efforts may identify compounds binding to non-physiological conformations. This requires prior demonstration of proper folding and binding capability.

Final Recommendation & Action Plan

Given the uncertainties in folding and functionality, recommend a stepped approach: First, perform biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality. Antibody development can proceed as the lowest-risk application. Avoid all interaction and binding studies until proper folding is confirmed. For reliable functional data, validate using known RB1 binding partners if possible. Always include appropriate controls and consider using full-length RB1 from eukaryotic systems for critical functional studies. The partial fragment may be most suitable for structural studies and domain-specific antibody production rather than full functional analysis.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Tumor suppressor that is a key regulator of the G1/S transition of the cell cycle. The hypophosphorylated form binds transcription regulators of the E2F family, preventing transcription of E2F-responsive genes. Both physically blocks E2Fs transactivating domain and recruits chromatin-modifying enzymes that actively repress transcription. Cyclin and CDK-dependent phosphorylation of RB1 induces its dissociation from E2Fs, thereby activating transcription of E2F responsive genes and triggering entry into S phase. RB1 also promotes the G0-G1 transition upon phosphorylation and activation by CDK3/cyclin-C. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. Mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex.; (Microbial infection) In case of viral infections, interactions with SV40 large T antigen, HPV E7 protein or adenovirus E1A protein induce the disassembly of RB1-E2F1 complex thereby disrupting RB1's activity.
Gene References into Functions
  1. Concurrent mutations, in genes such as CDKN2B or RB1, were associated with worse clinical outcome in lung adenocarcinoma patients with EGFR active mutations. PMID:29343775
  2. Mutational screening of germline RB1 gene in Vietnamese patients with retinoblastoma reveals three novel mutations. PMID:29568217
  3. Analyses with phospho-defective and phospho-mimetic mutants of FoxM1b identified a critical role of the Plk1 phosphorylation sites in regulating the binding of FoxM1b to Rb and DNMT3b. PMID:28387346
  4. The accumulation of sequence variations in RB1 gene might influence Greek patients' susceptibility towards the progression of cervical neoplasia. PMID:30303478
  5. vitiligo lesions exhibited dysregulated SUMOylation and deSUMOylation in keratinocytes, dysregulation of the cell cycle progression was observed in SUMO1 knockdown HaCaT cells and the deSUMOylation of Rb in keratinocytes may serve an important role in the development of vitiligo. PMID:30066925
  6. The Rb1 tumor suppressor gene modifies telomeric chromatin architecture by regulating TERRA expression. PMID:28169375
  7. These findings demonstrate that developmental stage-specific as well as species- and cell type-specific features sensitize to RB1 inactivation and reveal the human cone precursors' capacity to model retinoblastoma initiation, proliferation, premalignant arrest, and tumor growth. PMID:30213853
  8. Low pRB expression is associated with mouth Cancer. PMID:30275188
  9. Control of the Restriction Point by Rb and p21. PMID:30111539
  10. results showed that a) alterations of the p53 and Rb pathways are associated with high proliferation of tumor cells in BUC and b) high expression of cell-cycle proteins is associated with adverse histopathological parameters of these tumors PMID:29970521
  11. he present result indicated that vascular smooth proliferation is regulated by activation of the NF-kappaB p65/miR17/RB pathway. As NF-kappaB p65 signalling is activated in and is a master regulator of the inflammatory response, the present findings may provide a mechanism for the excessive proliferation of VSMCs under inflammation during vascular disorders and may identify novel targets for the treatment of vascular d... PMID:29115381
  12. Reduced RB expression in medullary thyroid cancer is associated with decreased patient survival in univariate and multivariable analyses, independent from patient age at surgery or advanced TNM stage. PMID:29105562
  13. According to immunohistochemistry and immunoblot analysis, the expression levels of cyclin D1, cyclin E, pRb, and Ki67 in psoriasis lesions decreased after treatment and were similar with those in the normal group PMID:29115643
  14. Data indicate that nuclear envelope rupture in cancer cells is likely due to loss of either the Rb or the p53 pathway. PMID:28811362
  15. Altered pRb is frequently expressed in gastric carcinoma, inversely correlates with tumor invasion and tumor stage suggesting an early event in gastric carcinogenesis. PMID:28965621
  16. results define a network of E2F target genes as susceptible to the regulatory influence of H1.2, where H1.2 augments global association of pRb with chromatin, enhances transcriptional repression by pRb, and facilitates pRb-dependent cell-cycle arrest PMID:28614707
  17. The increased expression of miR-503-5p significantly reduced the expressions of E2F transcription factor 3 (E2F3) mRNA and retinoblastoma protein (Rb)/E2F signaling pathway mRNA in bladder cancer cells. PMID:29169421
  18. Loss of Rb immunolabeling and KRAS mutation are promising molecular markers of the therapeutic response to platinum-based chemotherapy for pancreatic neuroendocrine neoplasm grade-3 (PanNEN-G3), and Rb for neuroendocrine tumor with G3 (NET-G3). PMID:28455360
  19. We recommend intensive ocular screening for patients with germline RB1 mutations for retinoblastoma as well as neuroimaging for pineoblastoma surveillance. There is an approximately 20% risk of developing second primary cancers among individuals with hereditary RB, higher among those who received radiotherapy for their primary RB tumors PMID:28674118
  20. The SNPs rs 216311, rs 1800383 and rs 1800386 associated significantly with bleeding in study subjects. rs1800386 occurred in all with bleeding history, no ethnic variations were noted. PMID:28091443
  21. miR-215 promoted cell migration and invasion of gastric cancer by directly targeting RB1. PMID:28689850
  22. MiR-661 promotes metastasis of non small cell lung cancer through RB/E2F1 signaling and epithelial-mesenchymal transition events. PMID:28716024
  23. RB1 was identified as a direct and functional target of miR-215. RB1 is generally down-regulated in glioma tissues and its expression inversely correlated with miR-215, which is up-regulated in high-grade glioma tissues, and its expression was negatively correlated with miR-215. PMID:28573541
  24. Loss of retinoblastoma in pleomorphic fibroma: An immunohistochemical and genomic analysis. PMID:28543636
  25. Results show that RB1 expression is regulated by cdc37 which facilitates its phosphorylation through increasing CDK4 stability. PMID:29288563
  26. SOX2 overexpression and the loss of Rb1 protein expression might have a pivotal role in the divergent differentiation of pluripotent embryonic-like epithelial cells and the development of esophageal small-cell carcinoma. PMID:28106103
  27. several RB1 alterations associated to retinoblastoma in the human were present in several non-human primates without an apparent pathological effect. PMID:28401291
  28. Results suggest that RB1 is the dominant tumor suppressor PP in MCC, and that inactivation of RB1 by MCPyV-LT is largely sufficient for its growth supporting function in established MCPyV-positive MCC cells. PMID:27121059
  29. the frequency and association of polymorphisms in the TP53 and RB1 genes with clinical characteristics in a group of children with retinoblastoma (RB) in northern Mexico, was examined. PMID:28210099
  30. RB underexpression is associated with tumor cell invasiveness and neuroendocrine differentiation in prostate cancer. PMID:27015368
  31. Authors show that MYC inhibition by Omomyc, a dominant-negative MYC, suppresses the growth of SCLC cells with TP53 and RB1 inactivation carrying MYC, MYCL, or MYCN amplification. PMID:27105536
  32. Data suggest that the platelet derived growth factor receptor alpha (PDGFRalpha)/Stat3 transcription factor/Rb1 protein regulatory axis might represent a potential therapeutic target for glioblastoma (GBM) treatment. PMID:27344175
  33. miR-590 inhibits RB1 and promotes proliferation and invasion of T-cell acute lymphoblastic leukaemia cells PMID:27036041
  34. causative RB1 mutations in most bilateral retinoblastoma (RB) patients and in some unilateral RB patients, including five novel mutations, were identified. PMID:29261756
  35. homozygous loss of RB1 is an independent prognostic marker in multiple myeloma PMID:28234347
  36. In certain contexts, Rb loss enables TRbeta1-dependent suppression of SKP2 as a safeguard against RB1-deficient tumorigenesis. TRbeta2 counteracts TRbeta1, thus disrupting this safeguard and promoting development of RB1-deficient malignancies. PMID:28972075
  37. Expression levels of miR-675-5p in glioma tissues and cells were negatively correlated with RB1 expression at both mRNA and protein levels and promoted cell proliferation and migration. PMID:28970140
  38. Disruption of DREAM and RB-E2F complexes by oncoproteins from DNA tumor viruses leads to upregulation of cell cycle genes and impairs growth-inhibiting pathways, including the p53-mediated downregulation of cell cycle genes. [review] PMID:28799433
  39. A relatively stable genome in retinoblastoma tumor cells is maintained by TRb1 and TRb2-mediated PTTG1 inhibition, counteracting Rb-deficiency-related genomic instability. PMID:28242412
  40. APC/C and pRB interact with each other via the co-activator of APC/C, FZR1, providing an alternative pathway of regulation of G1 to S transition by pRB using a post-translational mechanism. Both pRB and FZR1 have complex roles and are implicated not only in regulation of cell proliferation but also in differentiation, quiescence, apoptosis, maintenance of chromosomal integrity and metabolism. PMID:27402801
  41. Analysis of the spectrum of RB1 variants observed in 60,706 exomes identifies 197 variants that have enough potential to disrupt splicing to warrant further consideration. PMID:28780672
  42. AR also indirectly increases the expression of DNA replication genes through stimulatory effects on other metabolic genes with subsequent CDK activation and Rb hyperphosphorylation. PMID:27760327
  43. Rb gene promoter methylation was more frequent in gastric cancer patients than in controls. PMID:28319413
  44. We report the significance of genetic testing in the early detection and management of retinoblastoma from India. PMID:26914665
  45. Results show that the functional state of protein Rb is inferred to be inactive due its phosphorylation status in the MYCN-amplified retinoblastoma without coding sequence mutations. This makes inactivation of RB1 by gene mutation or by protein phosphorylation, a necessary condition for initiating retinoblastoma tumorigenesis, independent of MYCN amplification. PMID:28211617
  46. Low RB expression is associated with osteosarcoma. PMID:28655788
  47. Loss of RB1 is associated with papillomavirus involvement in Barrett's dysplasia and esophageal adenocarcinoma. PMID:28722212
  48. The epigenetic interaction between Linc00441 and bidirectional transcripted neighbor RB1 may be a de novo theory cutting-point for the inactivation of RB1 in HCC. PMID:28300839
  49. The data indicate that MAZ is essential to bypass MYB promoter repression by RB family members and to induce MYB expression. PMID:28973440
  50. RB inactivation enhances pro-inflammatory signaling through stimulation of the interleukin-6/STAT3 pathway, which directly promotes various malignant features of cancer cells. [review] PMID:28865172

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Retinoblastoma protein (RB) family
Tissue Specificity
Expressed in the retina. Expressed in foreskin keratinocytes (at protein level).
Database Links

HGNC: 9884

UNIGENE: Hs.408528

KEGG: hsa:5925

STRING: 9606.ENSP00000267163

OMIM: 109800

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products