Recombinant Human Recoverin (RCVRN)

CSB-YP019519HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$368

Quantity:

Express system: Yeast

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RCVRN

Uniprot NO.

P35243

Research Area

Neuroscience

Alternative Names

Cancer-associated retinopathy protein Short name: Protein CAR

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

2-200aa

Target Protein Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Mol. Weight

25.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light.

Gene References into Functions

High RCVRN expression is associated with renal tumors. PMID:26813565
Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands. PMID:26584024
C39D substitution reduces alpha-helical content, decreases thermal stability and suppresses membrane association. PMID:21344177
Aberrant hypomethylation of the recoverin gene region, overlapping the promoter up-stream of the first exon and the first exon itself, is involved in the aberrant expression of recoverin in tumor cells. PMID:20812967
recoverin has a pathological role in cancer-associated retinopathy PMID:12596918
There are cis-acting elements in the 5' non-coding region of the recoverin gene that are involved in the activation and suppression of gene expression. PMID:12789533
Human recoverin is expressed in SCLC cells cultured from an anti-recoverin antibody-negative patient with CAR. KK0206 might be important for further research on SCLC related retinopathy. PMID:17374419
A GRK1 region close to its C-terminus also seemed to be the binding site for S-modulin/recoverin. PMID:18266817

Hide All

Subcellular Location

Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment. Photoreceptor outer segment membrane; Lipid-anchor; Cytoplasmic side. Perikaryon.

Protein Families

Recoverin family

Tissue Specificity

Retina and pineal gland.

Database Links

HGNC: 9937

UNIGENE: Hs.80539

KEGG: hsa:5957

STRING: 9606.ENSP00000226193

OMIM: 179618

Promotions