Recombinant Human Proto-oncogene Wnt-1 (WNT1)

In Stock
Code: CSB-EP026128HU
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human WNT1 protein
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
WNT1
Uniprot NO.
Research Area
Cancer
Alternative Names
Proto-oncogene Int-1 homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-370aa
Target Protein Sequence
ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Plays an essential role in the development of the embryonic brain and central nervous system (CNS). Has a role in osteoblast function, bone development and bone homeostasis.
Gene References into Functions
  1. MiR301a increased the radiosensitivity and inhibited the migration of radioresistantESCC cells by targeting WNT1. PMID:30365079
  2. The WNT1 mutation disrupts feedback regulation between these miRNAs and WNT1, providing insights into the pathogenesis of WNT-related bone disorders. These miRNAs may have potential in the diagnosis and treatment of osteoporosis. PMID:29506076
  3. Taking together, these results suggest that Wnt/beta-catenin signal pathway activation-dependent up-regulation of syncytin-1 contributes to the pro-inflammatory factor TNF-alpha-enhanced fusion between oral squamous cell carcinoma cells and endothelial cells. PMID:28112190
  4. High WNT1 expression is associated with metastasis in cholangiocarcinoma. PMID:30193944
  5. We conclude that severe form of osteogenesis imperfecta (OI) may be associated with WNT1 mutation. This novel variant of WNT1 identified in achild with OI is likely cause for the disease. PMID:29481978
  6. MiR-185 inhibits colon cancer cell proliferation and invasion by targeting Wnt1. PMID:29454608
  7. High WNT1 expression is associated with epithelial-mesenchymal transition in gastric cancer. PMID:29273006
  8. Biallelic pathogenic splice acceptor site variant (c.359-3C>G) in WNT1 gene located on chromosome 12q13.12 underlying osteogenesis imperfecta type 3 in a Pakistani family. PMID:28665926
  9. Vertebral compression fractures were present in 78% (7/9) of those aged over 50years but were not seen in younger mutation-positive subjects. All those with fractures had several severely compressed vertebrae. Altogether spinal compression fractures were present in 39% of those with a WNT1 mutation. Only PMID:28411110
  10. miR-218 promoted the apoptosis of human ovarian carcinoma cells via suppression of the WNT/beta-catenin signaling pathway. PMID:28900081
  11. Data suggest that brain imaging be performed in any individual with WNT1-associated osteogenesis imperfecta (OI) who also has developmental delay or any neurological deficits. PMID:26671912
  12. Data indicate a tetracyclic azafluorenone, SJ26, that is capable of binding to G-quadruplex DNA structure, repressing WNT1 expression, and inhibiting cell migration. PMID:27626678
  13. Regulation of WNT signaling by VSX2 during optic vesicle patterning in human induced pluripotent stem cells has been described. PMID:27301076
  14. High WNT1 expression is associated with metastasis in triple-negative breast cancer. PMID:26967387
  15. WNT1 osteoporosis causes significant skeletal changes already in early childhood and impairs bone mass gain during pubertal years. PMID:27005318
  16. High WNT1 expression is associated with esophageal squamous cell carcinoma. PMID:29054489
  17. High WNT1 expression in stromal cells is associated with myelodysplastic syndrome. PMID:28684528
  18. High WNT1 expression is associated with gastric cancer. PMID:28223537
  19. Novel compound heterozygous WNT1 missense mutations, p.Glu123Asp and p.Cys153Gly, identified in a patient with osteogenesis imperfecta. PMID:28528193
  20. Osteocyte protein expression is altered in patients with osteoporosis caused by WNT1 mutation. PMID:28379384
  21. High WNT1 expression is associated with glioma cell invasion. PMID:27006177
  22. bone formation is under the control of WNT1 produced by osteocytes, the cells that reside deep in the bone matrix and form dendritic networks. PMID:28628035
  23. Knocking down of Wnt-1 by siRNA had the similar effect of miRNA-148a overexpression on cell migration and invasion in lung cancer cells. PMID:28199399
  24. High WNT1 expression is associated with Lung Adenocarcinoma Progression. PMID:27197183
  25. WNT1 overexpression is associated with Breast Cancer Invasion and Metastasis. PMID:27197202
  26. PKA signaling is pivotal in pigmentation process itself in cultured melanoma cells, while the importance of Wnt/beta-catenin signaling should be emphasized in the context of development and differentiation PMID:27567978
  27. Patients with WNT1 mutation-related osteoporosis respond to teriparatide treatment. PMID:27732335
  28. High WNT1 expression is associated with osteosarcoma. PMID:27665868
  29. These results suggest that alphaTAT1-mediated Wnt1 expression via microtubule acetylation is important for colon cancer progression. PMID:27836544
  30. Upregulation of WNT is associated with prostate cancer. PMID:28098905
  31. we introduced WNT1 gene as one of the important genes in Hepatocellular Carcinoma, and also, we showed that miR-122 can regulate WNT1 gene expression PMID:27687586
  32. Promoter hypermethylation of Wnt1 may play a crucial role in lung cancer carcinogenesis. PMID:27930522
  33. Overexpression of WNT1 is associated with hepatocellular carcinoma. PMID:27465549
  34. High WNT expression is associated with pancreatic cancer PMID:27485116
  35. The study expanded : Osteogenesis imperfecta (OI) spectrum and confirmed moderate to severe bone fragility induced by WNT1 defects. PMID:27450065
  36. Wnt1 expression was significantly higher in cutaneous squamous cell carcinoma samples than in the skin of control subjects. Wnt1 expression correlated with histopathological differentiation in cutaneous squamous cell carcinoma. PMID:27420949
  37. our results suggest that miR-148a can suppress the migration and invasion of breast cancer cells by targeting WNT-1 and inhibiting Wnt/beta-catenin signaling pathway and this will provide new insights into the molecular mechanisms of breast cancer metastasis PMID:26707142
  38. MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors. PMID:26421711
  39. IWR-1 has the potential to suppress tumor metastasis by inhibiting Wnt/beta-catenin pathway as well as survivin expression PMID:26450645
  40. High expression of WNT1 is associated with liver cancer. PMID:26499380
  41. Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways. PMID:26592459
  42. Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway. PMID:26214410
  43. Suggest that TGF-beta1/Smad and Wnt/CTNNB1 signaling pathways both contribute to pathological scar formation. PMID:26261683
  44. Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling. PMID:25909283
  45. Paracrine WNT signaling is stimulated by estrogen and progesterone, while autocrine WNT signaling is induced by the embryonic T-box transcription factor TBX3 PMID:25350852
  46. Wnt1 promotes CD36 expression via activation of PPAR-gamma and TCF4. PMID:25721714
  47. Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway. PMID:25677507
  48. WNT1 was a direct target of miR-148b, and overexpressed WNT1 inversely correlated with miR-148b levels in hepatocellular carcinoma tissues. PMID:25627001
  49. WNT/beta-catenin pathway and E-cadherin are important factors in advanced epithelial ovarian cancer. PMID:24499657
  50. Wnt1 stimulates osteogenic differentiation and mineralization of human periodontal ligament fibroblasts, mainly by activating the canonical Wnt/beta-catenin pathway, in which Runx2 is a key downstream regulator. PMID:25618247

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families
Wnt family
Database Links

HGNC: 12774

UNIGENE: Hs.248164

KEGG: hsa:7471

STRING: 9606.ENSP00000293549

OMIM: 164820

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products