Recombinant Human Protein jagged-2 (JAG2), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
JAG2
Uniprot NO.
Alternative Names
Protein jagged-2; Jagged2; hJ2; JAG2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
870-944
Target Protein Sequence
RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Putative Notch ligand involved in the mediation of Notch signaling. Involved in limb development.
Gene References into Functions
  1. In CL+/-P Malay patients, the prevalence of mutations in the Jagged2 gene was 12.5%. Three variants (g.19779C>T, g.19547G>A, and g.19712C>T) were identified in the Jagged2 gene among nonsyndromic CL+/-P and noncleft patients. Only g.19712C>T showed a significant association with nonsyndromic CL+/-P patients (P = .039). PMID:26151095
  2. these results show that the Notch signaling pathway in T cells is crucial for the induction of TH2-mediated allergic airway inflammation in an house dust mite -driven asthma model but that expression of Jagged 1 or Jagged 2 on DCs is not required PMID:28111308
  3. The authors present novel structures of human ligands Jagged2 and Delta-like4 and human Notch2, together with functional assays, which suggest that ligand-mediated coupling of membrane recognition and Notch binding is likely to be critical in establishing the optimal context for Notch signalling. PMID:28572448
  4. Immunohistochemistry showed a reverse correlation between MUC2 and Notch3 or Jagged1 (P = 0.033 and P = 0.005, respectively) and between MUC5AC and Jagged1 or Hes1 PMID:22691042
  5. Jagged-2 enhances immunomodulatory activity in adipose derived mesenchymal stem cells PMID:26412454
  6. Increased expression of JAG2, a target of miR-1280, is associated with high metastatic dissemination at diagnosis and a poor outcome in medulloblastoma. PMID:25576913
  7. Results show that tumor cell migration, invasion, and metastasis are dependent on JAGGED2 independently of NOTCH activation. PMID:25351917
  8. silencing prevents Notch2-driven osteoclast development and bone destruction in multiple myeloma PMID:25257302
  9. Although Jag1 shares a high degree of homology with Jag2 in the ectodomain region, BACE1 fails to cleave Jag2 effectively, indicating a selective cleavage of Jag1. PMID:24907271
  10. This study demonistrated that NOTCH ligands JAG1 and JAG2 as critical pro-survival factors in childhood medulloblastoma. PMID:24708907
  11. Jagged2 expression status was closely correlated with important histopathologic characteristics (grades and stages) and the recurrence and metastasis of bladder urothelial carcinomas. PMID:24228105
  12. Notch-1 and Jagged-2 are not expressed in spastic colon segments, which may be associated with the pathogenesis of Hirschsprung disease. PMID:22030773
  13. JAG2-mediated Notch activation confers phenotypic and functional aspects of Langerhans cell histiocytosis to dendritic cells. PMID:23074278
  14. JAG2 is often expressed by CD138(+) primary cells. Our results indicate that spontaneous clonogenic growth of myeloma cells requires the expression of JAG2. PMID:22341562
  15. This study is the first illustration of Notch-1 and Jagged-2 expression in human tissues from non-cancerous disease. PMID:21892607
  16. hypoxia-induced Jagged2 activation in both tumor invasive front and normal bone stroma has a critical role in tumor progression and metastasis PMID:21499308
  17. The stromal cell-mediated antiapoptotic effect on B- ALL cells is mediated by Notch-3 and -4 or Jagged-1/-2 and DLL-1 in a synergistic manner. PMID:21602525
  18. hypoxic induction of JAG2 in tumor cells mediates a hypoxia-regulated cross-talk between tumor and endothelial cells. PMID:21402725
  19. we have investigated their influence on early human hematopoiesis and show that Jagged2 affects hematopoietic lineage decisions very similarly as Delta-like-1 and -4, but very different from Jagged1 PMID:21372153
  20. Expression of Notch3 and Jagged2 were highly correlated in tongue carcinoma tissues. PMID:20819128
  21. Notch signaling may participate in controlling cell differentiation and proliferation in normal bone and COF of the jaws. Notch signaling disorder may be a molecular incident in COF occurrence and development. PMID:20040020
  22. JAG2 is a direct Myc target and Jagged2 and Notch signaling participate in P493-6 lymphomagenesis. PMID:20133585
  23. expression required for spermatogenesis in humans and rats PMID:11700865
  24. JAG2 was found to be overexpressed in malignant plasma cells from MM patients; coculture assay demonstrated that JAG2 induced the secretion of IL-6, VEGF, and IGF-1 in stromal cells; JAG2 overexpression may be an early event in the pathogenesis of MM PMID:15292061
  25. The upregulation of Jagged2 expression on BMEC was observed upon TNF-alpha activation. Similarly,activation of endothelial cells in Tie2-tmTNF-alpha mice was characterized by increased expression of Jagged2. PMID:18439488
  26. Results indicate JAG2 may be involved in non-syndromic cleft lip with or without cleft palate etiology in different populations. PMID:19049519
  27. SMRT function restoration induces JAG2 down-regulation as well as multipe myeloma apoptosis. PMID:19417136

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in heart, placenta and skeletal muscle and to a lesser extent in pancreas. Very low expression in brain, lung, liver and kidney.
Database Links

HGNC: 6189

UNIGENE: Hs.433445

KEGG: hsa:3714

STRING: 9606.ENSP00000328169

OMIM: 602570

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1