Recombinant Human Progesterone receptor (PGR), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PGR
Uniprot NO.
Alternative Names
Progesterone receptor; PR; Nuclear receptor subfamily 3 group C member 3; PGR NR3C3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
679-913
Target Protein Sequence
QDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as transcriptional activator or repressor.; Ligand-dependent transdominant repressor of steroid hormone receptor transcriptional activity including repression of its isoform B, MR and ER. Transrepressional activity may involve recruitment of corepressor NCOR2.; Transcriptional activator of several progesteron-dependent promoters in a variety of cell types. Involved in activation of SRC-dependent MAPK signaling on hormone stimulation.; Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.
Gene References into Functions
  1. We found that the Alu insertion was associated with breast cancer incidence in Indians and Indo-European mixed racial groups, but the association disappeared for patients of Caucasian or Latino decent. Our meta-analysis showed that the Alu-insertion progesterone receptor gene polymorphism was not associated with breast cancer. [Meta-analysis] PMID:29370776
  2. findings showed no association between PROGINS and leiomyoma in the overall analysis nor in either of the subgroups, Asian or non-Asian, in all genetic models;. conclusion: The PROGINS polymorphisms cannot be considered a risk factor for developing uterine leiomyoma - Systematic Review and Meta-Analysis PMID:29630404
  3. in primary breast tumors, PR-A expression was correlated negatively with miR-92a-3p expression and positively with miR-26b-5p expression. Therefore, hormonal cross-talk of PR-A with ER is probably a fundamental mechanism that enables metastasis of luminal breast cancer. PMID:29162724
  4. heterogeneous distribution in deep infiltrating endometriosis PMID:29383962
  5. This study aimed to determine the presence and localization of oestrogen receptors (ERs), progesterone receptors (PRs), and androgen receptors (ARs) in both healthy and varicose vein wall cells and their relationship with gender. PMID:30250632
  6. These findings suggest that in myometrial cells the repressive activity of PR-A on PR-B increases with advancing gestation and is induced by pro-inflammatory cytokines. PMID:28671036
  7. polymorphisms do not predict in vitro fertilization outcome PMID:29916276
  8. Data show that insulin-like growth factor-II mRNA-binding protein 2 and 3 (IMP2/3)-miR-200a-progesterone receptor axis represents a double-negative feedback loop and serves as a new potential therapeutic target for the treatment of Triple-negative breast cancer (TNBC). PMID:29217458
  9. The experimental data corroborated the inhibitory function of miR-513a-5p on progesterone receptor expression in breast cancer confirming that progesterone receptor is a target of miR-513a-5p PMID:29126102
  10. A major finding of our study is that one out of five (20%) patients with breast cancer BM had a receptor discrepancy between the primary tumor and the subsequent BM, with loss of hormone receptors (ER and/or PR) expression, and gain of HER2 overexpression as the most commonly observed changes PMID:28975433
  11. Single nucleotide polymorphism in progesterone receptor gene is associated with the risk of type 2 diabetes among Hispanic Americans compared to European American postmenopausal women. PMID:29417738
  12. In progesterone control of myometrial contractility during pregnancy and labour, while liganded nuclear progesterone receptor B can suppress the expression of Cx43, unliganded progesterone receptor A paradoxically translocates to the nucleus where it acts as a transcriptional activator of this labour gene. PMID:27220952
  13. Progesterone receptor, EGFR, and galectin-3 are expressed differentially in uterine smooth muscle tumors. PMID:29729689
  14. Estrogen receptor (ER) and progesterone receptor (PR) expression in endometrial carcinoma (EC) were significantly higher than those in the paracarcinoma tissue and control. PMID:29081408
  15. Alcohol consumption may have differential effects on concordant and discordant receptor subtypes of breast cancer. PMID:29353824
  16. General obesity, indicated by BMI, is more strongly associated with ER+/PR+ subtype, especially among premenopausal women, whereas central obesity, indicated by WHR, is more specific for ER-/PR- subtype, independent of menopausal status. These results suggest that different chemoprevention strategies may be appropriate in selected individuals. PMID:28912152
  17. TIMP-3 mRNA expression levels positively correlates with levels of miR-21 in in situ breast carcinomas and negatively in progesterone receptor positive invasive breast carcinomas. PMID:28935174
  18. results suggest differential downstream progesterone receptor signalling, as progesterone receptor regulates MMP3/10 expression via HIF1A, which is not involved in ADAMTS-1 expression PMID:28736153
  19. Association of progesterone receptor gene polymorphism with threatened abortion. PMID:29762972
  20. Villin, Pro-Ex-C and progesterone/estrogen receptor expression have diagnostic and predictive roles in endocervical and endometrioid adenocarcinoma. PMID:28832070
  21. These data collectively indicate that progesterone suppresses triple-negative breast cancer (TNBC) growth and metastasis via mPRalpha, which provides evidence of the anti-neoplastic effects of progesterone-mPRalpha pathway in the treatment of human TNBC. PMID:28713912
  22. Patients with Estrogen- and progesterone receptors-positive invasive lobular carcinoma (ILC) and invasive ductal carcinoma (IDC)have similar quantitative ER and PR expression profiles, implicating that ER/PR expression is unlikely to be a confounding factor in studies concerning chemo-sensitivity of ILC and IDC PMID:28365834
  23. The progesterone receptor B (PRB) and androgen Receptor (AR) mRNA levels were highest in tumors. PMID:29491078
  24. Chorionic gonadotropin activates Epac-Erk1/Erk2 signaling regulating progesterone receptor expression and function in human endometrial stromal cells. PMID:28333280
  25. Ten international pathology institutions participated in this study and determined messenger RNA expression levels of ERBB2, ESR1, PGR, and MKI67 in both centrally and locally extracted RNA from formalin-fixed, paraffin-embedded breast cancer specimens with the MammaTyper(R) test. Samples were measured repeatedly on different days within the local laboratories, and reproducibility was assessed by means of variance comp... PMID:28490348
  26. Human myometrial tissue in culture undergoes changes in progesterone receptor (PR) gene expression consistent with transition toward a laboring phenotype. TSA maintained the nonlaboring PR isoform expression pattern. PMID:28540297
  27. OHPg/PR-B through Beclin-1 and Bcl2 evoke autophagy-senescence transition in breast cancer cells PMID:27462784
  28. Report a significant survival benefit in lung adenocarcinoma patients with positive expression of one of the investigated hormonal receptors: androgen receptor, estrogen receptor-alpha or progesterone receptor. PMID:27690341
  29. We investigate the impact of central histology (n = 772), immunohistochemistry for intrinsic subtyping and IHC4, and dichotomous (GG) or continuous (GGI) genomic grade (n = 472) on patient outcome and benefit from taxane chemotherapy, focusing on HR+/HER2(HR: ER and/or PR)- patients (n = 459) PMID:27022068
  30. progesterone receptor expression status correlates with final pregnancy outcome PMID:27728856
  31. RA induced loss of PR binding only at the proximal site. Interestingly, RARalpha was recruited to the -1.1 kb PRE and the -130 bp PRE/RARE regions with P4, but not RA alone or RA plus P4 PMID:28692043
  32. the 5alpha-reduction of progesterone decreased PR activation significantly, 16alpha-hydroxyprogesterone and 16OH-dihydroprogesterone exhibited comparable receptor activation. PMID:27664517
  33. C/EBPbeta negatively regulates PR-B expression in glioblastoma cells. PMID:27663075
  34. Evaluation of progesterone expression in axillary lymph node metastasis of ER-positive, HER2-negative breast cancer may enable prediction of patients who are less likely to benefit from adjuvant tamoxifen. PMID:28416639
  35. Insight into previously reported associations between +331G/A polymorphism and breast cancer risk. [meta-analysis; review] PMID:29084518
  36. findings suggest that GATAD2B serves as an important mediator of progesterone-progesterone receptor suppression of proinflammatory and contractile genes during pregnancy; decreased GATAD2B expression near term may contribute to the decline in progesterone receptor function, leading to labor PMID:28576827
  37. The altered expression of ER and PR may be associated with the expression variation of integrin and pinopode formation in endometrium of luteal phase deficit women. PMID:27960568
  38. We sought to determine the relation between 17-alpha hydroxyprogesterone caproate plasma concentrations, progesterone receptor single nucleotide polymorphisms and single nucleotide polymorphisms in CYP3A4 and CYP3A5 and spontaneous preterm birth. PMID:28522317
  39. the estrogen- (ER), progesterone- (PgR) and HER2/neu receptor status of the primary tumor with brain metastases in a series of 24 consecutive breast cancer patients, is reported. PMID:28870906
  40. we found that combinatorial MK-2206+progesterone treatments decreased angiogenesis and proliferation in the Pten(d/d) conditional mouse model of endometrial cancer. Taken together, these findings suggest that a combinatorial therapeutic approach utilizing Akt inhibitors with progestins may improve the efficacy of progestin therapy for the treatment of endometrial cancer. PMID:26996671
  41. The interplay between intracellular progesterone receptor and PRKCA-PRKCD plays a key role in migration and invasion of human glioblastoma cells. PMID:27717886
  42. Folic acid inhibits colon cancer cell proliferation through activation of PR. PMID:27233474
  43. The endometrial expression of PR and Ki67 along with serum CA125 predicted the development of lymph node metastasis in endometrial cancer. PMID:27163153
  44. Overexpression of RNA-binding region-containing protein 1 (RNPC1) increased, whereas knockdown of RNPC1 decreased, the level of progesterone receptor (PR) protein and transcripts. PMID:27634883
  45. analysis of pancreatic adenocarcinoma reveals nPR and the presence of mPR of alpha, beta, gamma subtypes both at the mRNA and protein levels PMID:27449817
  46. Working model. During most of pregnancy, progesterone via PR-B promotes myometrial cell quiescence in part by repressing responsiveness to proinflammatory stimuli. With advancing gestation, prolabor signals increase the inflammatory load on the uterus until a threshold is reached. The threshold is the point at which inflammatory stimuli augment PR-A stability. PMID:27886516
  47. Choroidal metastases from BC are associated with ER and PR expression in the primary tumor and the luminal B molecular subtype. PMID:27479811
  48. Data suggest the relevance of determining the progesterone receptor (PR) isoform ratio before starting antiprogestin treatments. PMID:28376177
  49. The data show that human parturition involves the phosphorylation of PR-A at serine-345 in myometrial cells and that this process is ligand dependent and induced by a proinflammatory stimulus. PMID:27653036
  50. PR-B expression was significantly reduced in the eutopic endometrium (p=0.031) and ovarian endometrioma (p=0.036) from women with advanced-stage endometriosis compared with eutopic endometrium tissues from control subjects. PMID:27593876

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Nucleoplasmic shuttling is both hormone- and cell cycle-dependent. On hormone stimulation, retained in the cytoplasm in the G(1) and G(2)/M phases.; [Isoform A]: Nucleus. Cytoplasm. Note=Mainly nuclear.; [Isoform 4]: Mitochondrion outer membrane.
Protein Families
Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity
In reproductive tissues the expression of isoform A and isoform B varies as a consequence of developmental and hormonal status. Isoform A and isoform B are expressed in comparable levels in uterine glandular epithelium during the proliferative phase of th
Database Links

HGNC: 8910

UNIGENE: Hs.32405

KEGG: hsa:5241

STRING: 9606.ENSP00000325120

OMIM: 607311

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1